Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma -1.300 1.2e-03
invasive ductal carcinoma -1.100 7.3e-03
lung adenocarcinoma -2.400 3.3e-12
non-inflammatory breast cancer -1.200 2.2e-04

 Compartment GO Term (1)

AA Sequence

MLLAPPSTPSRGRTPSAVERLEADKAKYVKTHQVIARRQEPALRGSPGPLTPHPCNELGPPASPRTPRPV      1 - 70
RRGSGRRLPRPDSLIFYRQKRDCKASVNKENAKGQGLVRRLFLGAPRDAAPSSPASTERPAASGGWAAPQ     71 - 140
DAPEAAGKRALCPTCSLPLSEKERFFNYCGLERALVEVLGAERFSPQSWGADASPQAGTSPPPGSGDASD    141 - 210
WTSSDRGVDSPGGAGGGGGSEAAGSARDRRPPVSVVERNARVIQWLYGCQRARGPPRESEV             211 - 271
//

Text Mined References (5)

PMID Year Title