Property Summary

NCBI Gene PubMed Count 41
Grant Count 28
R01 Count 15
Funding $2,516,021.7
PubMed Score 92.09
PubTator Score 900.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -3.000 0.000
Atopic dermatitis 2.100 0.001
lung cancer -4.000 0.023
non primary Sjogren syndrome sicca 1.700 0.036
Breast cancer -1.600 0.000
chronic rhinosinusitis 3.263 0.017

Gene RIF (27)

PMID Text
25834826 The minimally invasive PTT procedure combined with Mucin 7 targeted GNPs is able to kill cancer cells and preserve healthy cells
23457413 A significant increase in sulfation was identified in salivary MUC7 from rheumatoid arthritis patients.
23002673 The present study did not disclose an association between MUC7*5/*6 and MUC7*6/*6 genotypes and gingival bleeding index.
22706105 The study did not show a correlation between the MUC7 genotypes and caries.
22167029 expression of different numbers of terminal repeats in this salivary mucin in the oral environment does not interfere with the etiopathogenesis of aggressive or chronic periodontitis
21647207 MUC7 expression in ductal adenocarcinoma (DAC) and chronic pancreatitis was not statistically significant, but MUC7 could be considered as potential marker of malignant lesions, especially in pancreatic DAC, as it was positive in 73% of these cases.
20946627 MUC5B and MUC7 from HIV patients, unlike the MUC5B and MUC7 from HIV negative individuals, did not inhibit HIV-1 activity.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKTLPLFVCICALSACFSFSEGRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRC      1 - 70
RPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTIS     71 - 140
SRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSATTQAPPSSSAPPE    141 - 210
TTAAPPTPPATTPAPPSSSAPPETTAAPPTPSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPET    211 - 280
TAAPPTPSATTPAPPSSPAPQETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSA    281 - 350
PGQNKISRFLLYMKNLLNRIIDDMVEQ                                               351 - 377
//

Text Mined References (44)

PMID Year Title
25834826 2015 Gold nanotheranostics: photothermal therapy and imaging of Mucin 7 conjugated antibody nanoparticles for urothelial cancer.
23457413 2013 Selected reaction monitoring to differentiate and relatively quantitate isomers of sulfated and unsulfated core 1 O-glycans from salivary MUC7 protein in rheumatoid arthritis.
23002673 2011 [Association of the polymorphism of MUC7 gene encoding the low-molecular-weight mucin MG2 with susceptibility to caries].
22706105 2012 The influence of polymorphism of the MUC7 gene on the teeth and dental hygiene of students at a faculty of dentistry in Poland.
22167029 2011 Genetic polymorphism of MUC7 in individuals with aggressive or chronic periodontitis.
21647207 2011 Mucin expression pattern in pancreatic diseases: findings from EUS-guided fine-needle aspiration biopsies.
21529783 2011 A quantitative-trait genome-wide association study of alcoholism risk in the community: findings and implications.
20946627 2010 Anti-HIV-1 activity of salivary MUC5B and MUC7 mucins from HIV patients with different CD4 counts.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
More...