Property Summary

NCBI Gene PubMed Count 45
PubMed Score 94.40
PubTator Score 900.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Asthma 385 0.0 4.0
Disease Target Count P-value
Breast cancer 3577 3.3e-19
psoriasis 6694 1.4e-07
lung cancer 4740 1.0e-03
Atopic dermatitis 952 1.2e-03
chronic rhinosinusitis 512 1.7e-02
non primary Sjogren syndrome sicca 891 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 1.0
Disease Target Count Z-score Confidence
Dental caries 164 3.907 2.0
Ethmoid sinusitis 1 3.745 1.9
Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis 2.100 1.2e-03
Breast cancer -1.600 3.3e-19
chronic rhinosinusitis 3.263 1.7e-02
lung cancer 2.000 1.0e-03
non primary Sjogren syndrome sicca 1.700 3.6e-02
psoriasis -2.400 1.4e-07

Gene RIF (31)

AA Sequence

MKTLPLFVCICALSACFSFSEGRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRC      1 - 70
RPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTIS     71 - 140
SRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSATTQAPPSSSAPPE    141 - 210
TTAAPPTPPATTPAPPSSSAPPETTAAPPTPSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPET    211 - 280
TAAPPTPSATTPAPPSSPAPQETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSA    281 - 350
PGQNKISRFLLYMKNLLNRIIDDMVEQ                                               351 - 377
//

Text Mined References (48)

PMID Year Title