Property Summary

NCBI Gene PubMed Count 32
Grant Count 76
R01 Count 61
Funding $7,212,738.71
PubMed Score 11.82
PubTator Score 44.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
non-small cell lung cancer -1.443 0.000
interstitial cystitis -2.200 0.001
pediatric high grade glioma 1.300 0.039
sonic hedgehog group medulloblastoma 1.300 0.013
invasive ductal carcinoma -2.900 0.000
breast carcinoma -1.700 0.000
Breast cancer -1.700 0.000
ductal carcinoma in situ -1.200 0.012
ovarian cancer -2.200 0.000

Synonym

Accession Q8TAX0 B3KV97 D6W521
Symbols ODD

Gene

Gene RIF (20)

PMID Text
26673921 SPAK and OSR1 are both stimulators of Kir2.1 activity.
26584301 OSR1 protein has both the potential to up-regulate KCNQ1/E1 protein abundance in the cell membrane, an effect possibly participating in the regulation of cell volume, excitability, epithelial transport and metabolism.
26506223 SPAK and OSR1 are powerful stimulators of the intestinal Na+-coupled phosphate co-transporter NaPi-IIb
26233565 SPAK and OSR1 are powerful negative regulators of the excitatory glutamate transporters EAAT1 and EAAT2.
26112741 SPAK and OSR1 are negative regulators of EAAT3 activity
25531585 Both, SPAK and OSR1, are negative regulators of the creatine transporter SLC6A8
25531100 OSR1 has the capacity to downregulate the peptide transporters PEPT1 and PEPT2 by decreasing the carrier protein abundance in the cell membrane
25515571 WNK 1, 3, 4, OSR1, and SPAK signaling system known to play a role in regulating the phosphorylation status, and hence activity of the CCCs in other tissues, is also present in the rat and human lenses.
25389294 The CCT domain directly interacts with the kinase domain to block substrate access and inhibit the domain-swapped homodimerization of the kinase domain of OSR1.
25362046 study identifies a separation of functions for the WNK1-activated protein kinases OSR1 and SPAK in mediating proliferation, invasion, and gene expression in endothelial cells
More...

AA Sequence

MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFS      1 - 70
KVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKPRFDFANLALAATQEDPAKLGRGEGP     71 - 140
GSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHK    141 - 210
AFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIKC                  211 - 266
//

Text Mined References (32)

PMID Year Title
26673921 2015 SPAK and OSR1 Sensitive Kir2.1 K+ Channels.
26584301 2015 SPAK and OSR1 Sensitive Cell Membrane Protein Abundance and Activity of KCNQ1/E1 K+ Channels.
26506223 2015 Up-Regulation of Intestinal Phosphate Transporter NaPi-IIb (SLC34A2) by the Kinases SPAK and OSR1.
26233565 2015 Down-Regulation of Excitatory Amino Acid Transporters EAAT1 and EAAT2 by the Kinases SPAK and OSR1.
26112741 2015 SPAK and OSR1 Sensitivity of Excitatory Amino Acid Transporter EAAT3.
25531585 2014 Negative regulation of the creatine transporter SLC6A8 by SPAK and OSR1.
25531100 2014 Downregulation of peptide transporters PEPT1 and PEPT2 by oxidative stress responsive kinase OSR1.
25515571 2014 Identification of the WNK-SPAK/OSR1 signaling pathway in rodent and human lenses.
25389294 2014 Structural and biochemical insights into the activation mechanisms of germinal center kinase OSR1.
25362046 2014 Actions of the protein kinase WNK1 on endothelial cells are differentially mediated by its substrate kinases OSR1 and SPAK.
More...