Property Summary

NCBI Gene PubMed Count 35
PubMed Score 15.04
PubTator Score 44.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -1.700 9.1e-12
breast carcinoma -1.700 4.0e-26
ductal carcinoma in situ -1.200 1.2e-02
interstitial cystitis -1.900 4.3e-04
invasive ductal carcinoma -1.346 4.9e-03
non-small cell lung cancer -1.443 2.0e-17
ovarian cancer -2.200 4.0e-15
pediatric high grade glioma 1.300 3.9e-02
sonic hedgehog group medulloblastoma 1.300 1.3e-02

Gene RIF (23)

AA Sequence

MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFS      1 - 70
KVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKPRFDFANLALAATQEDPAKLGRGEGP     71 - 140
GSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHK    141 - 210
AFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIKC                  211 - 266
//

Text Mined References (35)

PMID Year Title