Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.11
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.097 6.7e-07

AA Sequence

MLTRLVLSAHLSSTTSPPWTHAAISWELDNVLMPSPRIWPQVTPTGRSASVRSEGNTSSLWNFSAGQDVH      1 - 70
AIVTRTCESVLSSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPG     71 - 140
SGGPN                                                                     141 - 145
//

Text Mined References (4)

PMID Year Title