Property Summary

NCBI Gene PubMed Count 8
PubMed Score 233.40
PubTator Score 18.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 3.600 0.000
nasopharyngeal carcinoma -1.500 0.000
chronic rhinosinusitis -2.100 0.024
psoriasis -2.200 0.000

Gene RIF (1)

PMID Text
22538188 Amplification of the STOML3 gene is associated with mesenchymal differentiation in gliosarcoma.

AA Sequence

MDSRVSSPEKQDKENFVGVNNKRLGVCGWILFSLSFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQA      1 - 70
DKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQAT     71 - 140
FLLAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQRSMAAEAEA    141 - 210
TREARAKVLAAEGEMNASKSLKSASMVLAESPIALQLRYLQTLSTVATEKNSTIVFPLPMNILEGIGGVS    211 - 280
YDNHKKLPNKA                                                               281 - 291
//

Text Mined References (9)

PMID Year Title
22538188 2012 Amplification of the STOML3, FREM2, and LHFP genes is associated with mesenchymal differentiation in gliosarcoma.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12122055 2002 Stomatin-related olfactory protein, SRO, specifically expressed in the murine olfactory sensory neurons.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.