Property Summary

NCBI Gene PubMed Count 8
PubMed Score 265.60
PubTator Score 18.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 4.3e-19
nasopharyngeal carcinoma 1058 8.7e-06
ependymoma 4679 3.5e-03
chronic rhinosinusitis 512 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Metabolic syndrome X 52 0.0 1.2

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -2.100 2.4e-02
ependymoma 1.500 3.5e-03
nasopharyngeal carcinoma -1.500 8.7e-06
psoriasis -2.200 4.3e-19

Gene RIF (1)

AA Sequence

MDSRVSSPEKQDKENFVGVNNKRLGVCGWILFSLSFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQA      1 - 70
DKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQAT     71 - 140
FLLAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQRSMAAEAEA    141 - 210
TREARAKVLAAEGEMNASKSLKSASMVLAESPIALQLRYLQTLSTVATEKNSTIVFPLPMNILEGIGGVS    211 - 280
YDNHKKLPNKA                                                               281 - 291
//

Text Mined References (9)

PMID Year Title