Property Summary

NCBI Gene PubMed Count 22
PubMed Score 29.52
PubTator Score 32.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 0.000
psoriasis -4.600 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.300 0.000
adult high grade glioma -1.300 0.001

Synonym

Accession Q8TAV3
Symbols

Gene

Gene RIF (18)

PMID Text
26787547 Data suggest that canonical cytochrome P-450 reductants (cytochrome P450 reductase; cytochrome b5) cannot serve as electron donors for CYP2W1, a colon tumor-specific enzyme; glycosylation of CYP2W1 at Asn177 is required for full catalytic activity.
26683388 Report novel SNPs of CYP2W1 gene in Chinese Uygur and Han populations.
25844926 Results show the developmental expression of CYP2W1 in the GI tract mediated by epigenetic modifications, its specific location, and regulation by anticancer drugs which can be considered as an adjuvant therapy of colon and hepatic cancers.
25735388 Low KRT13 mRNA expression is associated with oral squamous cell carcinoma.
25144458 CYP2W1 is highly expressed in both normal and neoplastic adrenal glands making it a promising tool for targeted therapy in ACC
24801906 CYP2W1 could play an important role in hepatocellular carcinoma (HCC) and might serve as a valuable prognostic marker and potential target for gene therapy in the treatment of HCC.
24625228 High CYP2W1 expression is seen in 26% of primary colorectal tumors and in 48% of corresponding liver metastases.
24088132 No significant differences in the distribution of CYP2W1*1, CYP2W1*2 and CYP2W1*6 alleles were found between CRC patients and controls.
22993331 Results of the current study were in agreement with those of the previous pilot study and show that higher expression of CYP2W1 seems to be of prognostic value in colon cancer.
22631658 study did not detect an association between the CYP2W1, 4F11 and 8A1 genes polymorphisms and breast cancer risk in a Mexican population; however, some clinico-pathological risk factors interact with CYP2W1 genotypes and modifies susceptibility to breast cancer
More...

AA Sequence

MALLLLLFLGLLGLWGLLCACAQDPSPAARWPPGPRPLPLVGNLHLLRLSQQDRSLMELSERYGPVFTVH      1 - 70
LGRQKTVVLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGR     71 - 140
EPVADKILQELKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLGLIDEVMVLLG    141 - 210
SPGLQLFNVYPWLGALLQLHRPVLRKIEEVRAILRTLLEARRPHVCPGDPVCSYVDALIQQGQGDDPEGL    211 - 280
FAEANAVACTLDMVMAGTETTSATLQWAALLMGRHPDVQGRVQEELDRVLGPGRTPRLEDQQALPYTSAV    281 - 350
LHEVQRFITLLPHVPRCTAADTQLGGFLLPKGTPVIPLLTSVLLDETQWQTPGQFNPGHFLDANGHFVKR    351 - 420
EAFLPFSAGRRVCVGERLARTELFLLFAGLLQRYRLLPPPGVSPASLDTTPARAFTMRPRAQALCAVPRP    421 - 490
//

Text Mined References (24)

PMID Year Title
26787547 2016 Membrane topology and search for potential redox partners of colon cancer-specific cytochrome P450 2W1.
26683388 2015 Novel single nucleotide polymorphisms (SNPs) of CYP2W1 gene in Chinese Uygur and Han populations.
25844926 2015 Developmental regulation and induction of cytochrome P450 2W1, an enzyme expressed in colon tumors.
25735388 2015 KRT13, FAIM2 and CYP2W1 mRNA expression in oral squamous cell carcinoma patients with risk habits.
25144458 2014 CYP2W1 is highly expressed in adrenal glands and is positively associated with the response to mitotane in adrenocortical carcinoma.
24801906 2014 Prognostic value of CYP2W1 expression in patients with human hepatocellular carcinoma.
24625228 2014 The expression of CYP2W1 in colorectal primary tumors, corresponding lymph node metastases and liver metastases.
24278521 2010 Bioactivation of Aromatic Amines by Human CYP2W1, An Orphan Cytochrome P450 Enzyme.
24088132 2013 CYP2W1 polymorphism: functional aspects and relation to risk for colorectal cancer.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
More...