Property Summary

NCBI Gene PubMed Count 25
PubMed Score 30.71
PubTator Score 32.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.300 1.3e-03
atypical teratoid / rhabdoid tumor -1.100 7.5e-05
cutaneous lupus erythematosus -1.100 4.5e-04
glioblastoma -1.300 4.2e-05
psoriasis -1.400 2.3e-04

Gene RIF (21)

AA Sequence

MALLLLLFLGLLGLWGLLCACAQDPSPAARWPPGPRPLPLVGNLHLLRLSQQDRSLMELSERYGPVFTVH      1 - 70
LGRQKTVVLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGR     71 - 140
EPVADKILQELKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLGLIDEVMVLLG    141 - 210
SPGLQLFNVYPWLGALLQLHRPVLRKIEEVRAILRTLLEARRPHVCPGDPVCSYVDALIQQGQGDDPEGL    211 - 280
FAEANAVACTLDMVMAGTETTSATLQWAALLMGRHPDVQGRVQEELDRVLGPGRTPRLEDQQALPYTSAV    281 - 350
LHEVQRFITLLPHVPRCTAADTQLGGFLLPKGTPVIPLLTSVLLDETQWQTPGQFNPGHFLDANGHFVKR    351 - 420
EAFLPFSAGRRVCVGERLARTELFLLFAGLLQRYRLLPPPGVSPASLDTTPARAFTMRPRAQALCAVPRP    421 - 490
//

Text Mined References (27)

PMID Year Title