Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 6.3e-05

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.200 6.3e-05

Synonym

Accession Q8TAV0 B4DWT3 O95565 O95566 Q8N7J5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKP      1 - 70
CQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTK     71 - 140
EQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSP    141 - 210
GTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQA    211 - 280
KNRELLKQAAALSKSKKSEKSGAITSP                                               281 - 307
//

Text Mined References (6)

PMID Year Title