Knowledge Summary

Patent

No data available

Synonym

Accession Q8TAT8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MTERRRALSLAAVVDSINLACVVVSRDWLSLVPAFFYSPPPGGSFSGIKRESRRKRPSRNEIYGGGVLEQ      1 - 70
EVRMRRWSKTASPPVSLHHRPLGPARKP                                               71 - 98
//

Text Mined References (2)

PMID Year Title