Property Summary

NCBI Gene PubMed Count 26
PubMed Score 37.44
PubTator Score 41.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.300 8.8e-04
atypical teratoid / rhabdoid tumor 1.900 5.1e-08
Breast cancer 1.800 1.8e-12
glioblastoma 1.800 1.5e-07
group 3 medulloblastoma 1.600 4.9e-04
intraductal papillary-mucinous neoplasm ... 1.100 6.5e-03
invasive ductal carcinoma 1.200 6.5e-03
lung adenocarcinoma 1.500 9.4e-08
lung cancer 1.800 7.5e-03
medulloblastoma, large-cell 2.300 3.0e-05
osteosarcoma -2.386 8.9e-04
ovarian cancer 1.400 3.3e-05
primitive neuroectodermal tumor 2.000 8.9e-04
psoriasis 1.200 8.1e-46

Gene RIF (17)

AA Sequence

MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDSSQNVLSLFNG      1 - 70
YVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLEVQLTKDLICFFDSSVELRNS     71 - 140
MESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGDVLMDQNVLPGVGNIIKNEALFDSGLHPAVKV    141 - 210
CQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQ    211 - 280
KENPQHVDICKLPTRNTIISWTSSRVDHVMDSVARKSEEHWTCVVCTLINKPSSKACDACLTSRPIDSVL    281 - 350
KSEENSTVFSHLMKYPCNTFGKPHTEVKINRKTAFGTTTLVLTDFSNKSSTLERKTKQNQILDEEFQNSP    351 - 420
PASVCLNDIQHPSKKTTNDITQPSSKVNISPTISSESKLFSPAHKKPKTAQYSSPELKSCNPGYSNSELQ    421 - 490
INMTDGPRTLNPDSPRCSKHNRLCILRVVGKDGENKGRQFYACPLPREAQCGFFEWADLSFPFCNHGKRS    491 - 560
TMKTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGIKIIPGC                             561 - 605
//

Text Mined References (30)

PMID Year Title