Property Summary

NCBI Gene PubMed Count 20
PubMed Score 33.64
PubTator Score 41.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 8.10304013241036E-46
Breast cancer 3099 1.82172975330318E-12
atypical teratoid / rhabdoid tumor 4369 5.06368624457262E-8
lung adenocarcinoma 2714 9.38303187821313E-8
sonic hedgehog group medulloblastoma 1482 1.46361655603381E-7
pediatric high grade glioma 2712 3.74906504596769E-6
lung cancer 4473 7.53495465760358E-6
medulloblastoma, large-cell 6234 2.97349663178905E-5
ovarian cancer 8492 3.29856366305534E-5
glioblastoma 5572 1.02566059628895E-4
osteosarcoma 7933 8.92470223642036E-4
primitive neuroectodermal tumor 3031 8.93716721737607E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00653389162229742
invasive ductal carcinoma 2950 0.00654993125501418

Expression

  Differential Expression (14)

Synonym

Accession Q8TAT5 Q2PPJ3 Q8NG51 Q9NV95
Symbols FGP2
FPG2
NEI3
ZGRF3
hFPG2
hNEI3

Gene

  Ortholog (10)

Gene RIF (11)

PMID Text
25703835 NEIL3 rs12645561 SNP TT genotype was associated with increased risk of myocardial infarction.
24005813 Polymorphisms within FLT3, EGFR, NEIL3, and ALOX5 may contribute to the occurrence of GBM.
23926102 one role for Neil3 and NEIL1 is to repair DNA base damages in telomeres in vivo and that Neil3 and Neil1 may function in quadruplex-mediated cellular events, such as gene regulation via removal of damaged bases from quadruplex DNA.
23755964 Results show that the base excision and strand incision activities of NEIL3 exhibited a non-concerted action, indicating that NEIL3 mainly operates as a monofunctional DNA glycosylase.
22569481 Here we report the construction of bicistronic expression vectors for expressing in Escherichia coli the full-length mouse Neil3 (MmuNeil3), its glycosylase domain (MmuNeil3Delta324), as well as the glycosylase domain of human Neil3 (NEIL3Delta324).
22365498 both the transcription and protein levels of hNEIL3 fluctuated during the cell cycle
19170771 NEIL3 partially rescues an E. coli nth nei mutant from hydrogen peroxide sensitivity. Taken together, repair of certain base damage including base loss in ssDNA may be mediated by NEIL3.
18976975 Knockdown of nei endonuclease VIII-like 3 (NEIL3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18515411 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDSSQNVLSLFNG      1 - 70
YVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLEVQLTKDLICFFDSSVELRNS     71 - 140
MESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGDVLMDQNVLPGVGNIIKNEALFDSGLHPAVKV    141 - 210
CQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQ    211 - 280
KENPQHVDICKLPTRNTIISWTSSRVDHVMDSVARKSEEHWTCVVCTLINKPSSKACDACLTSRPIDSVL    281 - 350
KSEENSTVFSHLMKYPCNTFGKPHTEVKINRKTAFGTTTLVLTDFSNKSSTLERKTKQNQILDEEFQNSP    351 - 420
PASVCLNDIQHPSKKTTNDITQPSSKVNISPTISSESKLFSPAHKKPKTAQYSSPELKSCNPGYSNSELQ    421 - 490
INMTDGPRTLNPDSPRCSKHNRLCILRVVGKDGENKGRQFYACPLPREAQCGFFEWADLSFPFCNHGKRS    491 - 560
TMKTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGIKIIPGC                             561 - 605
//

Text Mined References (24)

PMID Year Title
25703835 2015 Genetic variants in the DNA repair gene NEIL3 and the risk of myocardial infarction in a nested case-control study. The HUNT Study.
24005813 2013 Association of polymorphisms in FLT3, EGFR, ALOX5, and NEIL3 with glioblastoma in the Han Chinese population.
23926102 2013 Neil3 and NEIL1 DNA glycosylases remove oxidative damages from quadruplex DNA and exhibit preferences for lesions in the telomeric sequence context.
23755964 2013 Human NEIL3 is mainly a monofunctional DNA glycosylase removing spiroimindiohydantoin and guanidinohydantoin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22569481 2012 Expression and purification of active mouse and human NEIL3 proteins.
22365498 2012 Release from quiescence stimulates the expression of human NEIL3 under the control of the Ras dependent ERK-MAP kinase pathway.
19426544 2009 Expression patterns of Neil3 during embryonic brain development and neoplasia.
19170771 2009 Human Nei-like protein NEIL3 has AP lyase activity specific for single-stranded DNA and confers oxidative stress resistance in Escherichia coli mutant.
19121397 2009 Expression and purification of NEIL3, a human DNA glycosylase homolog.
More...