Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.22
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
oligodendroglioma 1.100 0.000
osteosarcoma -2.341 0.000
glioblastoma 1.100 0.007
atypical teratoid / rhabdoid tumor 3.600 0.000
primitive neuroectodermal tumor 2.900 0.002
pediatric high grade glioma 1.200 0.020
group 3 medulloblastoma 2.100 0.000
pilocytic astrocytoma 2.000 0.000
inflammatory breast cancer -1.100 0.005
pituitary cancer 1.200 0.000

Gene RIF (1)

PMID Text
18669637 the FGF binding domain and the heparin binding domain are necessary for the hBP3 interaction with endogenous FGF and the activation of FGFR signaling in vivo

AA Sequence

MTPPKLRASLSPSLLLLLSGCLLAAARREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEA      1 - 70
AAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKG     71 - 140
HGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRK    141 - 210
AALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG                          211 - 258
//

Text Mined References (7)

PMID Year Title
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
18669637 2008 Effect of FGF-binding protein 3 on vascular permeability.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.