Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.42
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 2.000 8.7e-05
atypical teratoid / rhabdoid tumor 3.600 1.5e-09
glioblastoma 1.100 7.4e-03
group 3 medulloblastoma 2.100 3.4e-04
inflammatory breast cancer -1.100 5.2e-03
oligodendroglioma 1.100 5.4e-06
osteosarcoma -2.341 2.7e-08
pediatric high grade glioma 1.200 2.0e-02
pituitary cancer 1.200 1.3e-04
primitive neuroectodermal tumor 2.900 2.0e-03

Gene RIF (1)

AA Sequence

MTPPKLRASLSPSLLLLLSGCLLAAARREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEA      1 - 70
AAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKG     71 - 140
HGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRK    141 - 210
AALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG                          211 - 258
//

Text Mined References (7)

PMID Year Title