Property Summary

NCBI Gene PubMed Count 17
Grant Count 36
R01 Count 12
Funding $4,792,970.29
PubMed Score 503.61
PubTator Score 58.41

Knowledge Summary

Patent (6,144)

Expression

Gene RIF (14)

PMID Text
23419774 Moreover, we showed that CATS and KIS antagonize the transactivation capacity of CALM/AF10.In summary, our results show that CATS interacts with and is a substrate for KIS, suggesting that KIS regulates CATS function
21399567 The contribution of UHMK1 gene in schizophrenia susceptibility, was explored.
19747464 KIS is expressed in neurons, and its encoded protein is localised to the nucleus and cytoplasm. No difference in KIS expression was found between schizophrenics and controls or in the lymphoblast cell lines.
19747464 Observational study of gene-disease association. (HuGE Navigator)
18414510 The association between UHMK1 and schizophrenia is confirmed.
18414510 A follow up article showing further association between markers in UHMK1 and schizophrenia in a London based sample. Association replicated in an independent Scottish sample.
18414510 Observational study of gene-disease association. (HuGE Navigator)
18384876 Overexpression of KIS protein kinase is associated with acute myelogenous leukemia, myelodysplastic syndrome and acute lymphoblastic leukemia
17984092 Results show that KIS is a direct transcriptional target of FoxM1.
17726090 KIS promoter is activated by serum-responsive GABP binding to Ets-binding sites which leads to KIS gene expression, cell migration, and cell cycle progression
More...

AA Sequence

MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAE      1 - 70
YGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCAR     71 - 140
DVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQ    141 - 210
AGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDL    211 - 280
IKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEE    281 - 350
CQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL     351 - 419
//

Text Mined References (19)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
23419774 2013 The CATS (FAM64A) protein is a substrate of the Kinase Interacting Stathmin (KIS).
21399567 2011 Genetic and molecular exploration of UHMK1 in schizophrenic patients.
19747464 2009 Expression of kinase interacting with stathmin (KIS, UHMK1) in human brain and lymphoblasts: Effects of schizophrenia and genotype.
18414510 2008 Confirmation of the genetic association between the U2AF homology motif (UHM) kinase 1 (UHMK1) gene and schizophrenia on chromosome 1q23.3.
18384876 2008 KIS induces proliferation and the cell cycle progression through the phosphorylation of p27Kip1 in leukemia cells.
18316326 2008 Exploration of human ORFeome: high-throughput preparation of ORF clones and efficient characterization of their protein products.
17984092 2008 FoxM1 regulates growth factor-induced expression of kinase-interacting stathmin (KIS) to promote cell cycle progression.
17726090 2008 GA-binding protein regulates KIS gene expression, cell migration, and cell cycle progression.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
More...