Property Summary

NCBI Gene PubMed Count 17
PubMed Score 503.61
PubTator Score 58.41

Knowledge Summary

Patent (6,144)

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.800 6.7e-03
osteosarcoma 2.242 1.3e-05
medulloblastoma -1.200 6.0e-05
medulloblastoma, large-cell -1.500 3.0e-03
juvenile dermatomyositis 1.239 1.2e-08
Amyotrophic Lateral Sclerosis 1.337 7.0e-06
acute quadriplegic myopathy 1.745 9.2e-06
intraductal papillary-mucinous adenoma (... 2.200 2.1e-03
intraductal papillary-mucinous carcinoma... 1.900 8.6e-04
intraductal papillary-mucinous neoplasm ... 1.800 3.3e-02
sarcoidosis 1.400 2.0e-02
Breast cancer 4.200 2.4e-02
invasive ductal carcinoma 1.227 3.4e-03
Pick disease 1.900 1.8e-04
ovarian cancer 1.900 4.9e-05

Gene RIF (14)

PMID Text
23419774 Moreover, we showed that CATS and KIS antagonize the transactivation capacity of CALM/AF10.In summary, our results show that CATS interacts with and is a substrate for KIS, suggesting that KIS regulates CATS function
21399567 The contribution of UHMK1 gene in schizophrenia susceptibility, was explored.
19747464 KIS is expressed in neurons, and its encoded protein is localised to the nucleus and cytoplasm. No difference in KIS expression was found between schizophrenics and controls or in the lymphoblast cell lines.
19747464 Observational study of gene-disease association. (HuGE Navigator)
18414510 The association between UHMK1 and schizophrenia is confirmed.
18414510 A follow up article showing further association between markers in UHMK1 and schizophrenia in a London based sample. Association replicated in an independent Scottish sample.
18414510 Observational study of gene-disease association. (HuGE Navigator)
18384876 Overexpression of KIS protein kinase is associated with acute myelogenous leukemia, myelodysplastic syndrome and acute lymphoblastic leukemia
17984092 Results show that KIS is a direct transcriptional target of FoxM1.
17726090 KIS promoter is activated by serum-responsive GABP binding to Ets-binding sites which leads to KIS gene expression, cell migration, and cell cycle progression
16978587 These results provide preliminary evidence that the UHMK1 gene increases susceptibility to schizophrenia. Further confirmation in adequately powered samples is needed.
16978587 Evidence indicating that UHMK1 may be a candidate susceptibility gene for Schizophrenia in the British population. UHMK1 is situated between previously implicated genes RGS4 and NOS1AP.
12782393 KIS gene was overexpressed in NF1-associated plexiform neurofibromas and malignant peripheral nerve sheath tumors (MPNSTs) as compared to dermal neurofibroma which suggests a possible implication of KIS in the genesis of NF1-associated tumors.
12093740 We identify the kinase responsible for S10 phosphorylation as human kinase interacting stathmin (hKIS) and show that it regulates cell cycle progression in response to mitogens.

AA Sequence

MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAE      1 - 70
YGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCAR     71 - 140
DVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQ    141 - 210
AGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDL    211 - 280
IKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEE    281 - 350
CQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL     351 - 419
//

Text Mined References (19)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
23419774 2013 The CATS (FAM64A) protein is a substrate of the Kinase Interacting Stathmin (KIS).
21399567 2011 Genetic and molecular exploration of UHMK1 in schizophrenic patients.
19747464 2009 Expression of kinase interacting with stathmin (KIS, UHMK1) in human brain and lymphoblasts: Effects of schizophrenia and genotype.
18414510 2008 Confirmation of the genetic association between the U2AF homology motif (UHM) kinase 1 (UHMK1) gene and schizophrenia on chromosome 1q23.3.
18384876 2008 KIS induces proliferation and the cell cycle progression through the phosphorylation of p27Kip1 in leukemia cells.
18316326 2008 Exploration of human ORFeome: high-throughput preparation of ORF clones and efficient characterization of their protein products.
17984092 2008 FoxM1 regulates growth factor-induced expression of kinase-interacting stathmin (KIS) to promote cell cycle progression.
17726090 2008 GA-binding protein regulates KIS gene expression, cell migration, and cell cycle progression.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16978587 2007 Fine mapping by genetic association implicates the chromosome 1q23.3 gene UHMK1, encoding a serine/threonine protein kinase, as a novel schizophrenia susceptibility gene.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12782393 2003 Quantitative RT-PCR reveals a ubiquitous but preferentially neural expression of the KIS gene in rat and human.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12093740 2002 A growth factor-dependent nuclear kinase phosphorylates p27(Kip1) and regulates cell cycle progression.
10574929 1999 The novel kinase peptidylglycine alpha-amidating monooxygenase cytosolic interactor protein 2 interacts with the cytosolic routing determinants of the peptide processing enzyme peptidylglycine alpha-amidating monooxygenase.