Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
Funding $183,395.33
PubMed Score 10.70
PubTator Score 10.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19193627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
12498619 cDNA of Macaca fascicularis used to identify a novel human gene, SUNC1.

AA Sequence

MSGKTKARRAAMFFRRCSEDASGSASGNALLSEDENPDANGVTRSWKIILSTMLTLTFLLVGLLNHQWLK      1 - 70
ETDVPQKSRQLYAIIAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNFRQILFLIEQIDVLKALLRDM     71 - 140
KDGMDNNHNWNTHGDPVEDPDHTEEVSNLVNYVLKKLREDQVEMADYALKSAGASIIEAGTSESYKNNKA    141 - 210
KLYWHGIGFLNHEMPPDIILQPDVYPGKCWAFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSGNISSA    211 - 280
PKEFSVYGITKKCEGEEIFLGQFIYNKTGTTVQTFELQHAVSEYLLCVKLNIFSNWGHPKYTCLYRFRVH    281 - 350
GTPGKHI                                                                   351 - 357
//

Text Mined References (9)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19193627 2009 A two-stage genome-wide association study of sporadic amyotrophic lateral sclerosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12498619 2002 Cynomolgus monkey testicular cDNAs for discovery of novel human genes in the human genome sequence.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.