Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 5
Funding $200,414.58
PubMed Score 1.48
PubTator Score 5.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.700 0.013
hepatocellular carcinoma 1.600 0.000
pancreatic cancer 1.400 0.037
oligodendroglioma -1.200 0.021
osteosarcoma -1.538 0.003
tuberculosis -1.800 0.001
sarcoidosis 1.100 0.048
group 4 medulloblastoma 1.200 0.007
pancreatic carcinoma 1.400 0.037
psoriasis -1.200 0.000
lung carcinoma 1.100 0.000
ovarian cancer -1.400 0.000

Gene RIF (6)

PMID Text
25961932 Functional importance of H3K9me3 in hypoxia, apoptosis and repression of APAK.
25691462 ARF coordinates Apak to regulate ribosome biogenesis upon cellular stress.
22334068 Apak competes with p53 for binding to inhibit p53AIP1 expression.
20713054 Apak is differentially regulated in the ARF and ATM-dependent manner in response to oncogenic stress and DNA damage, respectively.
19629643 four of seven types of DNA damage signals examined resulted in significant Apak phosphorylation and dissociation of Apak from p53, releasing the inhibition of p53 transcriptional activity
19377469 Apak (ZNF420 or FLJ32191) is a negative regulator of p53-mediated apoptosis.

AA Sequence

MARKLVMFRDVAIDFSQEEWECLDSAQRDLYRDVMLENYSNLVSLDLPSRCASKDLSPEKNTYETELSQW      1 - 70
EMSDRLENCDLEESNSRDYLEAKGKMEKQQENQKEYFRQGMIIYDKMSIFNQHTYLSQHSRCHSTEKPYK     71 - 140
CKECGKAFRRASHLTQHQSIHTGEKPYECKQCGKAFSRDSQLSLHQRLHTGEKPYACKECGKAFTQSSQL    141 - 210
ILHHRIHTGEKPYKCEECGKAFIRSSQLTRHQKVHTGEKPYECKECGKAFTQNSQLTLHQRLHTGEKLYE    211 - 280
CKECRKVFTQLSQLILHKRIHTGEKPYECKECGKAFICGSQLSQHQKIHNGEKPYECKECGRAFIRGSLL    281 - 350
MQHQRIHTGEKPYKCEECGKAFIRGSQLTQHQRIHTNEKPYECKECGKMFSHGSQLTQHQRIHTGEKPYQ    351 - 420
CKECGKAFNRGSLLTRHQRIHTGEKPYECKECGKTFSRGSELTQHERIHTGEKPYECKECGKSFIRGSQL    421 - 490
TQHQRIHTGEKPYECKECRMAFTQSSHLSQHQRLHTGEKPYVCNECGKAFARGLLLIQHQRIHTGEKPYQ    491 - 560
CKECGKAFIRGSQLTQHQRIHTGEKPYECKECGKAFSHGSQLTLHQRIHTGEKPYECRECRKAFTQSSHL    561 - 630
SRHQRIHTGEKPYQCKECGKAFTRGSQLTQHQRIHISEKSFEYKECGIDFSHGSQVYM                631 - 688
//

Text Mined References (12)

PMID Year Title
26544568 2015 Outlier Analysis Defines Zinc Finger Gene Family DNA Methylation in Tumors and Saliva of Head and Neck Cancer Patients.
25961932 2016 H3K9me3 facilitates hypoxia-induced p53-dependent apoptosis through repression of APAK.
25691462 2015 ARF-mediated SUMOylation of Apak antagonizes ubiquitylation and promotes its nucleolar accumulation to inhibit 47S pre-rRNA synthesis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22334068 2012 Apak competes with p53 for direct binding to intron 1 of p53AIP1 to regulate apoptosis.
20713054 2010 ARF-dependent regulation of ATM and p53 associated KZNF (Apak) protein activity in response to oncogenic stress.
19629643 2010 Differential regulation of Apak by various DNA damage signals.
19377469 2009 KRAB-type zinc-finger protein Apak specifically regulates p53-dependent apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...