Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.48
PubTator Score 5.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.700 1.3e-02
group 4 medulloblastoma 1.200 7.0e-03
hepatocellular carcinoma 1.600 2.4e-04
lung carcinoma 1.100 1.9e-14
oligodendroglioma -1.200 2.1e-02
osteosarcoma 1.337 7.1e-03
ovarian cancer -1.300 1.7e-04
pancreatic cancer 1.400 3.7e-02
pancreatic carcinoma 1.400 3.7e-02
psoriasis -1.200 3.3e-09
sarcoidosis 1.100 4.8e-02
tuberculosis -1.800 8.7e-04

Gene RIF (6)

AA Sequence

MARKLVMFRDVAIDFSQEEWECLDSAQRDLYRDVMLENYSNLVSLDLPSRCASKDLSPEKNTYETELSQW      1 - 70
EMSDRLENCDLEESNSRDYLEAKGKMEKQQENQKEYFRQGMIIYDKMSIFNQHTYLSQHSRCHSTEKPYK     71 - 140
CKECGKAFRRASHLTQHQSIHTGEKPYECKQCGKAFSRDSQLSLHQRLHTGEKPYACKECGKAFTQSSQL    141 - 210
ILHHRIHTGEKPYKCEECGKAFIRSSQLTRHQKVHTGEKPYECKECGKAFTQNSQLTLHQRLHTGEKLYE    211 - 280
CKECRKVFTQLSQLILHKRIHTGEKPYECKECGKAFICGSQLSQHQKIHNGEKPYECKECGRAFIRGSLL    281 - 350
MQHQRIHTGEKPYKCEECGKAFIRGSQLTQHQRIHTNEKPYECKECGKMFSHGSQLTQHQRIHTGEKPYQ    351 - 420
CKECGKAFNRGSLLTRHQRIHTGEKPYECKECGKTFSRGSELTQHERIHTGEKPYECKECGKSFIRGSQL    421 - 490
TQHQRIHTGEKPYECKECRMAFTQSSHLSQHQRLHTGEKPYVCNECGKAFARGLLLIQHQRIHTGEKPYQ    491 - 560
CKECGKAFIRGSQLTQHQRIHTGEKPYECKECGKAFSHGSQLTLHQRIHTGEKPYECRECRKAFTQSSHL    561 - 630
SRHQRIHTGEKPYQCKECGKAFTRGSQLTQHQRIHISEKSFEYKECGIDFSHGSQVYM                631 - 688
//

Text Mined References (13)

PMID Year Title