Property Summary

NCBI Gene PubMed Count 35
PubMed Score 15.19
PubTator Score 11.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.4e-07
Pick disease 1894 1.7e-06
oligodendroglioma 2850 9.6e-04
progressive supranuclear palsy 676 8.8e-03
astrocytic glioma 2597 9.1e-03
ependymoma 4679 2.2e-02
Rheumatoid arthritis 1191 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Coffin-Siris syndrome 17 3.321 1.7
triple-A syndrome 17 3.12 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.300 9.1e-03
ependymoma 1.300 2.2e-02
oligodendroglioma 1.800 9.6e-04
ovarian cancer -1.200 1.4e-07
Pick disease 1.300 1.7e-06
progressive supranuclear palsy 1.200 8.8e-03
Rheumatoid arthritis 1.200 3.6e-02

Gene RIF (6)

AA Sequence

MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSN      1 - 70
APLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRP     71 - 140
NIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPD    141 - 210
SYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDE    211 - 280
VNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVP    281 - 350
NVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQ    351 - 420
THHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNL    421 - 490
AGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQQTSASQQMLN    491 - 560
FPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSR    561 - 630
TQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEF    631 - 700
SKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKK    701 - 770
EPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVE    771 - 840
SEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELE    841 - 910
TIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQPPPALPPGSQPIPPTGAAGP    911 - 980
PAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTAGPQQQQPAGAPQPGAVPPGVPPPGPHGPSP    981 - 1050
FPNQQTPPSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHH   1051 - 1120
HHLPFAPGTLPPPNLPVSMANPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPD   1121 - 1190
PGTPLPPDPTAPSPGTVTPVPPPQ                                                 1191 - 1214
//

Text Mined References (50)

PMID Year Title