Property Summary

NCBI Gene PubMed Count 13
PubMed Score 53.53
PubTator Score 11.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 2.400 3.0e-02
ovarian cancer 1.800 1.1e-03

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHG      1 - 70
GSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYF     71 - 140
KPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC                                   141 - 179
//

Text Mined References (19)

PMID Year Title