Property Summary

NCBI Gene PubMed Count 19
PubMed Score 14.75
PubTator Score 10.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Gene RIF (9)

AA Sequence

MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRL      1 - 70
FGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGY     71 - 140
APQVR                                                                     141 - 145
//

Text Mined References (20)

PMID Year Title