Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.96
PubTator Score 9.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.200 4.3e-02
astrocytoma -1.900 2.2e-06
Astrocytoma, Pilocytic -3.900 1.1e-06
atypical teratoid / rhabdoid tumor -2.200 3.6e-02
ependymoma -4.700 2.1e-02
glioblastoma -2.400 3.2e-03
group 3 medulloblastoma -4.900 3.9e-04
hepatocellular carcinoma -1.200 1.8e-03
medulloblastoma, large-cell -4.000 8.1e-04
oligodendroglioma -2.500 1.6e-07
primitive neuroectodermal tumor -3.300 3.0e-03
progressive supranuclear palsy -1.400 1.8e-02
subependymal giant cell astrocytoma -5.531 2.6e-03
tuberculosis and treatment for 6 months 1.100 3.2e-03

Synonym

Accession Q8TAM6 B4DKA6 Q9ULN1
Symbols JN
KIAA1189

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLL      1 - 70
NSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLK     71 - 140
EEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKH    141 - 210
EEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFES    211 - 280
MMHL                                                                      281 - 284
//

Text Mined References (13)

PMID Year Title