Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.13
PubTator Score 9.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 6.62371552597808E-20
oligodendroglioma 2849 1.64795934263969E-7
pilocytic astrocytoma 3086 1.06506541559042E-6
astrocytoma 1493 2.21223599068644E-6
pediatric high grade glioma 2712 2.75428130099769E-6
glioblastoma 5572 2.11651646000487E-4
group 3 medulloblastoma 2254 3.88138830807215E-4
atypical teratoid/rhabdoid tumor 1095 5.88014702713825E-4
medulloblastoma, large-cell 6234 8.11227833098288E-4
hepatocellular carcinoma 550 0.00175682103543353
subependymal giant cell astrocytoma 2287 0.00259304093821187
primitive neuroectodermal tumor 3031 0.00302204198365614
tuberculosis and treatment for 6 months 686 0.00323024332459535
progressive supranuclear palsy 674 0.0175336834392799
Disease Target Count Z-score Confidence
Choledochal cyst 3 4.24 2.1
Echinococcosis 28 3.062 1.5

Expression

  Differential Expression (14)

Synonym

Accession Q8TAM6 B4DKA6 Q9ULN1
Symbols JN
KIAA1189

Gene

  Ortholog (8)

Gene RIF (4)

PMID Text
20934411 this study suggested a role for hErmin as a novel cytoskeleton-related oligodendroglial protein in human brain myelination and human epileptogenesis, and provide new evidence for the relationship between oligodendrocytes and epilepsy.
20468071 Observational study of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.

AA Sequence

MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLL      1 - 70
NSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLK     71 - 140
EEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKH    141 - 210
EEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFES    211 - 280
MMHL                                                                      281 - 284
//

Text Mined References (13)

PMID Year Title
20934411 2011 Human Ermin (hErmin), a new oligodendrocyte-specific cytoskeletal protein related to epileptic seizure.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421295 2006 Ermin, a myelinating oligodendrocyte-specific protein that regulates cell morphology.
16051705 2005 Juxtanodin: an oligodendroglial protein that promotes cellular arborization and 2',3'-cyclic nucleotide-3'-phosphodiesterase trafficking.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...