Property Summary

NCBI Gene PubMed Count 25
PubMed Score 3.72
PubTator Score 11.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (7)

Disease log2 FC p
Endometriosis -1.405 4.6e-02
ependymoma 1.600 2.6e-11
lung carcinoma 1.700 5.4e-28
ovarian cancer -1.800 1.9e-09
Pick disease -1.100 5.3e-04
spina bifida -1.018 3.9e-02
subependymal giant cell astrocytoma 1.861 1.0e-02

Gene RIF (6)

AA Sequence

MSSEMEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQEPDPELPVHQAAWILKARALTEMVYIDEIDVD      1 - 70
QEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIR     71 - 140
TPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTIH    141 - 210
LEDVVLHLGIYPFLLRNKNHIEKNALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQ    211 - 280
QEMVDTFLYLAKVYVSLDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNT    281 - 350
HVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEE    351 - 420
EAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHM    421 - 490
YEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAML                       491 - 541
//

Text Mined References (26)

PMID Year Title