Property Summary

NCBI Gene PubMed Count 22
Grant Count 64
R01 Count 37
Funding $8,910,310.88
PubMed Score 59.52
PubTator Score 42.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma 1.900 0.018
osteosarcoma -2.076 0.000
posterior fossa group A ependymoma -3.200 0.000
sonic hedgehog group medulloblastoma -3.900 0.000
atypical teratoid/rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -3.900 0.002
tuberculosis -2.100 0.003
pilocytic astrocytoma 1.700 0.000
psoriasis -1.800 0.000

Synonym

Accession Q8TAK6 Q7RTS0 Oligo1
Symbols BHLHB6
BHLHE21

Gene

PANTHER Protein Class (2)

Gene RIF (11)

PMID Text
25930075 This study demonstrated that increased expression of mRNA of OLIG1 in ventral prefrontal white matter in major depressive disorder.
23720758 Olig1 is a Smad cofactor involved in TGF-beta-induced cell motility
23165259 This study review OLIG1 have developmental functions in patterning, neuron subtype specification and the formation of oligodendrocytes and play the role in the postnatal brain during repair processes and in neurological disease states.
21446039 Olig1 was not expressed in freshly isolated oligodendrocytes, but is expressed from the beginning of process extension until membrane maintenance.
21206754 analysis of conserved and non-conserved functional elements at the Olig1 and Olig2 locus
17690840 No significan correlation was found between proliferation index in pilocytic astrocytomas and Olig-1 expression.
17388669 OLIG1 protein expression significantly correlates with overall survival in non-small cell lung cancer patients
17283288 Observational study of gene-disease association. (HuGE Navigator)
17171653 Mutations in OLIG1 and OLIG2 are not likely to be associated with this subgroup of hypomyelinating disorders.
16820418 identified novel coding variants in the Olig1 gene, including a trinucleotide repeat, but found no evidence to support the hypothesis that genetic variation in Olig1 influences susceptibility to multiple sclerosis
More...

AA Sequence

MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAR      1 - 70
EKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHC     71 - 140
QGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGP    141 - 210
PDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK             211 - 271
//

Text Mined References (23)

PMID Year Title
25930075 2015 Oligodendrocyte morphometry and expression of myelin - Related mRNA in ventral prefrontal white matter in major depressive disorder.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
23720758 2013 Oligodendrocyte transcription factor 1 (Olig1) is a Smad cofactor involved in cell motility induced by transforming growth factor-?.
23165259 2012 Separated at birth? The functional and molecular divergence of OLIG1 and OLIG2.
21446039 2011 Olig1 is expressed in human oligodendrocytes during maturation and regeneration.
21206754 2010 A systematic enhancer screen using lentivector transgenesis identifies conserved and non-conserved functional elements at the Olig1 and Olig2 locus.
18923419 2008 An Id-like molecule, HHM, is a synexpression group-restricted regulator of TGF-beta signalling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17690840 2008 Expression of oligodendroglial differentiation markers in pilocytic astrocytomas identifies two clinical subsets and shows a significant correlation with proliferation index and progression free survival.
17388669 2007 Aberrant DNA methylation of OLIG1, a novel prognostic factor in non-small cell lung cancer.
More...