Property Summary

NCBI Gene PubMed Count 23
PubMed Score 65.29
PubTator Score 42.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.700 1.5e-06
atypical teratoid / rhabdoid tumor -3.400 2.8e-04
ependymoma -2.900 6.1e-04
group 3 medulloblastoma -3.300 2.1e-03
medulloblastoma, large-cell -3.900 1.5e-03
oligodendroglioma 1.900 1.8e-02
osteosarcoma -2.076 1.2e-05
psoriasis -1.800 4.5e-19
tuberculosis -2.100 3.2e-03

Gene RIF (12)

AA Sequence

MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAR      1 - 70
EKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHC     71 - 140
QGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGP    141 - 210
PDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK             211 - 271
//

Text Mined References (24)

PMID Year Title