Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.79
PubTator Score 4.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.400 9.8e-03
astrocytic glioma -1.900 7.7e-03
Astrocytoma, Pilocytic -1.500 1.7e-04
atypical teratoid / rhabdoid tumor -2.000 7.2e-07
ependymoma -1.700 3.6e-02
glioblastoma -1.600 1.5e-03
group 4 medulloblastoma -1.500 5.3e-03
medulloblastoma, large-cell -2.300 1.2e-04
oligodendroglioma -1.900 8.9e-03
ovarian cancer 1.300 1.4e-11
primitive neuroectodermal tumor -1.800 7.7e-04

Gene RIF (6)

AA Sequence

MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLVDTAGQDEYSIL      1 - 70
PYSFIIGVHGYVLVYSVTSLHSFQVIESLYQKLHEGHGKTRVPVVLVGNKADLSPEREVQAVEGKKLAES     71 - 140
WGATFMESSARENQLTQGIFTKVIQEIARVENSYGQERRCHLM                               141 - 183
//

Text Mined References (15)

PMID Year Title