Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.54
PubTator Score 4.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.43482862080615E-11
medulloblastoma 1524 1.6607162812849E-7
atypical teratoid / rhabdoid tumor 4369 7.19332857455513E-7
medulloblastoma, large-cell 6234 1.16133907784156E-4
pilocytic astrocytoma 3086 2.16087634273745E-4
primitive neuroectodermal tumor 3031 7.67221928067064E-4
glioblastoma 5572 0.00148824789254431
astrocytic glioma 2241 0.00772158265252812
oligodendroglioma 2849 0.00892181927683231
adult high grade glioma 2148 0.00978462125734947
ependymoma 2514 0.0360581897700445
Disease Target Count Z-score Confidence
Renal clear cell carcinoma 5 3.492 1.7
Lymphangioleiomyomatosis 17 3.169 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.900 0.008
ependymoma -1.700 0.036
oligodendroglioma -1.900 0.009
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
glioblastoma -1.600 0.001
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.800 0.001
adult high grade glioma -1.400 0.010
pilocytic astrocytoma -1.500 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q8TAI7 Q56VH8
Symbols RHEBL1c

Gene

PDB

3OES  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Pathway (1)

Gene RIF (5)

PMID Text
25422319 These results establish CAD as a downstream effector of Rheb and suggest a possible role of Rheb in regulating de novo pyrimidine nucleotide synthesis.(Rheb small GTPases, which consist of Rheb1 and Rheb2 (also known as RhebL1)
24127550 Findings are unprecedented and indicate that the DHH-RHEBL1 fusion transcript is a novel recurrent feature in the changing landscape of CBFA2T3-GLIS2-positive childhood AML.
21655954 RhebL1 may be impacting the mTOR pathway in a different manner than Rheb1.
16328882 RHEBL1 is a positive regulator of NF-kappa B-mediated gene transcription.
16098514 Data show that Rheb like-1 protein (RhebL1) rescues mTOR signaling during nutrient withdrawal, and identify critical residues in Rheb and RhebL1 which are required for their efficient activation of mTOR signaling.

AA Sequence

MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLVDTAGQDEYSIL      1 - 70
PYSFIIGVHGYVLVYSVTSLHSFQVIESLYQKLHEGHGKTRVPVVLVGNKADLSPEREVQAVEGKKLAES     71 - 140
WGATFMESSARENQLTQGIFTKVIQEIARVENSYGQERRCHLM                               141 - 183
//

Text Mined References (14)

PMID Year Title
25422319 2015 Rheb protein binds CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamoylase, and dihydroorotase) protein in a GTP- and effector domain-dependent manner and influences its cellular localization and carbamoyl-phosphate synthetase (CPSase) activity.
25416956 2014 A proteome-scale map of the human interactome network.
24127550 2013 DHH-RHEBL1 fusion transcript: a novel recurrent feature in the new landscape of pediatric CBFA2T3-GLIS2-positive acute myeloid leukemia.
21655954 2012 Effects of RhebL1 silencing on the mTOR pathway.
17162089 2007 Activation of the mTOR signaling pathway in renal clear cell carcinoma.
16328882 2005 Identification and characterization of RHEBL1, a novel member of Ras family, which activates transcriptional activities of NF-kappa B.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16098514 2005 Analysis of mTOR signaling by the small G-proteins, Rheb and RhebL1.
16006564 2005 The farnesyl transferase inhibitor (FTI) SCH66336 (lonafarnib) inhibits Rheb farnesylation and mTOR signaling. Role in FTI enhancement of taxane and tamoxifen anti-tumor activity.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
More...