Property Summary

NCBI Gene PubMed Count 27
Grant Count 27
R01 Count 18
Funding $1,568,920.47
PubMed Score 35.06
PubTator Score 13.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 0.017
ependymoma -1.400 0.027
osteosarcoma -1.229 0.008
glioblastoma -1.500 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.100 0.002
intraductal papillary-mucinous carcinoma... 1.100 0.003
adult high grade glioma -1.300 0.001
subependymal giant cell astrocytoma -1.244 0.029

Gene RIF (8)

PMID Text
23435566 NDR2-mediated Rabin8 phosphorylation is crucial for ciliogenesis by triggering the switch in binding specificity of Rabin8 from PS to Sec15.
22534017 HIV-1 Nef immunocomplexes analyzed by mass spectrometry reveal that exocyst complex component 6 (EXOC6) is a Nef-binding protein in Jurkat cells
21044367 Observational study of gene-disease association. (HuGE Navigator)
20944747 coordinated disruption of the Rab11/Sec15 exocyst by anthrax toxins may contribute to toxin-dependent barrier disruption and vascular dysfunction during B. anthracis infection
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16478783 The SEC15 protein plays a crucial role in integrating the signals between Sec4p and the components of the early-polarity-establishment machinery.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15292201 Sec15 has a role as an effector for the Rab11 GTPase in mammalian cells

AA Sequence

MAENSESLGTVPEHERILQEIESTDTACVGPTLRSVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHH      1 - 70
QGFVDAITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVEKLQLCLPVLE     71 - 140
MYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEISMSDLKDFLESIRKH    141 - 210
SDKIGETAMKQAQHQKTFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEEDENEEEILTVQDL    211 - 280
VDFSPVYRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILH    281 - 350
VTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLTVIFADTLQGYGFPVNRLFDLLFEI    351 - 420
RDQYNETLLKKWAGVFRDIFEEDNYSPIPVVNEEEYKIVISKFPFQDPDLEKQSFPKKFPMSQSVPHIYI    421 - 490
QVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQA    491 - 560
CKYLEDFITNITNISQETVHTTRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRAS    561 - 630
GYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELF    631 - 700
ASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKKNN    701 - 770
IFAQFRKNDRDKQKLIETVVKQLRSLVNGMSQHM                                        771 - 804
//

Text Mined References (30)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26299925 2015 A potential link between insulin signaling and GLUT4 translocation: Association of Rab10-GTP with the exocyst subunit Exoc6/6b.
25964651 2015 Architectures of multisubunit complexes revealed by a visible immunoprecipitation assay using fluorescent fusion proteins.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
24856041 2014 Exocyst complex protein expression in the human placenta.
24563720 2013 Exocyst proteins in cytokinesis: Regulation by Rab11.
23435566 2013 NDR2-mediated Rabin8 phosphorylation is crucial for ciliogenesis by switching binding specificity from phosphatidylserine to Sec15.
22685325 2012 Rab11 regulates exocytosis of recycling vesicles at the plasma membrane.
22534017 2012 Proteomic analysis of HIV-1 Nef cellular binding partners reveals a role for exocyst complex proteins in mediating enhancement of intercellular nanotube formation.
22433857 2012 A Rab8 guanine nucleotide exchange factor-effector interaction network regulates primary ciliogenesis.
More...