Property Summary

NCBI Gene PubMed Count 28
PubMed Score 35.83
PubTator Score 13.86

Knowledge Summary


No data available


  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 6.8e-04
astrocytic glioma -1.300 1.7e-02
ependymoma -1.400 2.7e-02
glioblastoma -1.500 7.0e-06
intraductal papillary-mucinous carcinoma... 1.100 3.0e-03
medulloblastoma -1.100 4.9e-04
medulloblastoma, large-cell -1.100 2.1e-03
osteosarcoma -1.229 7.6e-03
subependymal giant cell astrocytoma -1.244 2.9e-02


Accession Q8TAG9 E9PHI3 Q5VXH8 Q9NZ24
Symbols SEC15


PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (10)

Gene RIF (8)

AA Sequence

IFAQFRKNDRDKQKLIETVVKQLRSLVNGMSQHM                                        771 - 804

Text Mined References (31)

PMID Year Title