Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Alzheimer's disease -1.500 2.6e-02
atypical teratoid / rhabdoid tumor -3.000 1.6e-06
ependymoma -1.900 4.5e-05
glioblastoma -2.200 2.1e-02
group 3 medulloblastoma -2.900 3.6e-02
medulloblastoma, large-cell -3.200 2.2e-03
non primary Sjogren syndrome sicca -1.200 1.9e-02
pediatric high grade glioma -1.700 2.3e-02
Pick disease -1.800 2.4e-04
primitive neuroectodermal tumor -2.000 4.6e-02
psoriasis -1.300 1.8e-32
subependymal giant cell astrocytoma -2.691 2.9e-02

AA Sequence

MMHQIYSCSDENIEVFTTVIPSKVSSPARRRAKSSQHLLTKNVVIESDLYTHQPLELLPHRGDRRDPGDR      1 - 70
RRFGRLQTARPPTAHPAKASARPVGISEPKTSNLCGNRAYGKSLIPPVPRISVKTSASASLEATAMGTEK     71 - 140
GAVLMRGSRHLKKMTEEYPALPQGAEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATNSAFEAD       141 - 207
//

Text Mined References (4)

PMID Year Title