Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q8TAG6 B2RDC3 B4DFU4 C9J814 C9JCS3
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MMHQIYSCSDENIEVFTTVIPSKVSSPARRRAKSSQHLLTKNVVIESDLYTHQPLELLPHRGDRRDPGDR      1 - 70
RRFGRLQTARPPTAHPAKASARPVGISEPKTSNLCGNRAYGKSLIPPVPRISVKTSASASLEATAMGTEK     71 - 140
GAVLMRGSRHLKKMTEEYPALPQGAEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATNSAFEAD       141 - 207
//

Text Mined References (4)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.