Property Summary

NCBI Gene PubMed Count 10
PubMed Score 98.56
PubTator Score 30.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.100 2.2e-24

Gene RIF (6)

AA Sequence

MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWIGDSVNTPQAGYFGLFSYCVG      1 - 70
NVLSSELICKGGPLDFSSIPSRAFKTAMFFVALGMFLIIGSIICFSLFFICNTATVYKICAWMQLAAATG     71 - 140
LMIGCLVYPDGWDSSEVRRMCGEQTGKYTLGHCTIRWAFMLAILSIGDALILSFLAFVLGYRQDKLLPDD    141 - 210
YKADGTEEV                                                                 211 - 219
//

Text Mined References (14)

PMID Year Title