Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 6.7e-06
cystic fibrosis 1696 7.9e-05
ovarian cancer 8520 2.4e-04

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.800 7.9e-05
lung adenocarcinoma 1.200 6.7e-06
ovarian cancer -1.500 2.4e-04

Synonym

Accession Q8TAF5
Symbols LQK1
NCRNA00292

 Compartment GO Term (0)

AA Sequence

MARGLLHLRVGGRRPRGLCCWKKGSRSRPQERVLGSTSGKNWRRVTERSEGSKFIGIYSVRECKSSDCRR      1 - 70
RNSRPSVVSLLRGSCEEL                                                         71 - 88
//

Text Mined References (3)

PMID Year Title