Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.800 0.000
lung adenocarcinoma 1.200 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q8TAF5
Symbols LQK1
NCRNA00292

Gene

 Compartment GO Term (0)

AA Sequence

MARGLLHLRVGGRRPRGLCCWKKGSRSRPQERVLGSTSGKNWRRVTERSEGSKFIGIYSVRECKSSDCRR      1 - 70
RNSRPSVVSLLRGSCEEL                                                         71 - 88
//

Text Mined References (3)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11943475 2002 Genomic structure and evolutionary context of the human feline leukemia virus subgroup C receptor (hFLVCR) gene: evidence for block duplications and de novo gene formation within duplicons of the hFLVCR locus.