Property Summary

NCBI Gene PubMed Count 27
PubMed Score 24.14
PubTator Score 14.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.6e-02
non primary Sjogren syndrome sicca 1.300 2.9e-02
ovarian cancer 1.100 1.7e-03

Gene RIF (14)

AA Sequence

MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGV      1 - 70
VPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQR     71 - 140
ENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAV    141 - 210
AQDPAASGAPSS                                                              211 - 222
//

Text Mined References (35)

PMID Year Title