Property Summary

NCBI Gene PubMed Count 25
Grant Count 7
R01 Count 7
Funding $596,275.33
PubMed Score 20.58
PubTator Score 14.13

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 0.036
non primary Sjogren syndrome sicca 1.300 0.029
ovarian cancer 1.100 0.002

Synonym

Accession Q8TAE8 Q8IVM3 Q8TE51 Q969P9 Q9BSM6
Symbols PRG6
CRIF1
PLINP
CKBBP2
Plinp1
MRP-L59
PLINP-1
CKbetaBP2

Gene

PDB

3J9M   3J7Y  

Gene RIF (13)

PMID Text
26210498 Study shows that Lck interacts with CRIF1 in the mitochondria and negatively regulates CRIF1-mediated translation of mitochondrion-encoded proteins.
25997448 our results support a novel function of nuclear Lck in promoting human leukemic T cell survival through interaction with a tumor suppressor, CRIF1
25847389 Crif1 is an indispensable regulator of PKAalpha cat that modulates the PKA/CREB signaling pathway to promote adipogenic differentiation of bone marrow mesenchymal stem cells after irradiation
25361083 The results identify the ROS-Sp1-Crif1 pathway to be a new mechanism underlying Abeta-induced mitochondrial dysfunction and suggest that ROS-mediated downregulation of Crif1 is a crucial event in AD pathology.
24906005 CRIF1 knockdown partially induces endothelial activation via increased ROS production and phosphorylation of p66shc
24520316 CRIF1 may play a regulatory role in the BM microenvironment-induced leukemia cell cycle arrest possibly through interacting with CDK2 and acting as a cyclin-dependent kinase inhibitor.
24103312 CKbetaBP2/CRIF1 is expressed with STAT3 in prostate cancer where STAT3 may help to offset the AR repressor effect of CKbetaBP2/CRIF1.
21911160 results indicated cell cycle arrest of Jurkat cells in the G0/G1 phase to be induced by primary cultured leukemic BMSCs associated with increased expression of CRIF1 by leukemic cells
20427290 CRIF1, unlike KEAP1 (which only interacts with N-terminal region of NRF2), physically interacts with both N- and C-terminal regions of NRF2 and promotes NRF2 ubiquitination and subsequent proteasome-mediated NRF2 protein degradation
17885209 Results suggest that CRIF1 acts as an AR corepressor and may play an important role in the regulation of AR-positive growth of prostate cancer.
More...

AA Sequence

MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGV      1 - 70
VPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQR     71 - 140
ENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAV    141 - 210
AQDPAASGAPSS                                                              211 - 222
//

Text Mined References (31)

PMID Year Title
26210498 2015 Lymphocyte-specific protein tyrosine kinase (Lck) interacts with CR6-interacting factor 1 (CRIF1) in mitochondria to repress oxidative phosphorylation.
25997448 2015 Nuclear lymphocyte-specific protein tyrosine kinase and its interaction with CR6-interacting factor 1 promote the survival of human leukemic T cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25847389 2015 Crif1 Promotes Adipogenic Differentiation of Bone Marrow Mesenchymal Stem Cells After Irradiation by Modulating the PKA/CREB Signaling Pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25361083 2015 CR6-interacting factor 1 is a key regulator in A?-induced mitochondrial disruption and pathogenesis of Alzheimer's disease.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24906005 2014 CRIF1 deficiency induces p66shc-mediated oxidative stress and endothelial activation.
24520316 2014 CRIF1 interacting with CDK2 regulates bone marrow microenvironment-induced G0/G1 arrest of leukemia cells.
24103312 2014 Mechanism of androgen receptor corepression by CK?BP2/CRIF1, a multifunctional transcription factor coregulator expressed in prostate cancer.
More...