Property Summary

NCBI Gene PubMed Count 25
PubMed Score 20.58
PubTator Score 14.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 0.00165673948093215
non primary Sjogren syndrome sicca 840 0.0288331067168851
group 3 medulloblastoma 2254 0.0359742287588278

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 0.036
non primary Sjogren syndrome sicca 1.300 0.029
ovarian cancer 1.100 0.002

Synonym

Accession Q8TAE8 Q8IVM3 Q8TE51 Q969P9 Q9BSM6
Symbols PRG6
CRIF1
PLINP
CKBBP2
Plinp1
MRP-L59
PLINP-1
CKbetaBP2

Gene

PDB

3J9M   3J7Y  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid

Gene RIF (13)

PMID Text
26210498 Study shows that Lck interacts with CRIF1 in the mitochondria and negatively regulates CRIF1-mediated translation of mitochondrion-encoded proteins.
25997448 our results support a novel function of nuclear Lck in promoting human leukemic T cell survival through interaction with a tumor suppressor, CRIF1
25847389 Crif1 is an indispensable regulator of PKAalpha cat that modulates the PKA/CREB signaling pathway to promote adipogenic differentiation of bone marrow mesenchymal stem cells after irradiation
25361083 The results identify the ROS-Sp1-Crif1 pathway to be a new mechanism underlying Abeta-induced mitochondrial dysfunction and suggest that ROS-mediated downregulation of Crif1 is a crucial event in AD pathology.
24906005 CRIF1 knockdown partially induces endothelial activation via increased ROS production and phosphorylation of p66shc
24520316 CRIF1 may play a regulatory role in the BM microenvironment-induced leukemia cell cycle arrest possibly through interacting with CDK2 and acting as a cyclin-dependent kinase inhibitor.
24103312 CKbetaBP2/CRIF1 is expressed with STAT3 in prostate cancer where STAT3 may help to offset the AR repressor effect of CKbetaBP2/CRIF1.
21911160 results indicated cell cycle arrest of Jurkat cells in the G0/G1 phase to be induced by primary cultured leukemic BMSCs associated with increased expression of CRIF1 by leukemic cells
20427290 CRIF1, unlike KEAP1 (which only interacts with N-terminal region of NRF2), physically interacts with both N- and C-terminal regions of NRF2 and promotes NRF2 ubiquitination and subsequent proteasome-mediated NRF2 protein degradation
17885209 Results suggest that CRIF1 acts as an AR corepressor and may play an important role in the regulation of AR-positive growth of prostate cancer.
More...

AA Sequence

MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGV      1 - 70
VPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQR     71 - 140
ENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAV    141 - 210
AQDPAASGAPSS                                                              211 - 222
//

Text Mined References (31)

PMID Year Title
26210498 2015 Lymphocyte-specific protein tyrosine kinase (Lck) interacts with CR6-interacting factor 1 (CRIF1) in mitochondria to repress oxidative phosphorylation.
25997448 2015 Nuclear lymphocyte-specific protein tyrosine kinase and its interaction with CR6-interacting factor 1 promote the survival of human leukemic T cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25847389 2015 Crif1 Promotes Adipogenic Differentiation of Bone Marrow Mesenchymal Stem Cells After Irradiation by Modulating the PKA/CREB Signaling Pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25361083 2015 CR6-interacting factor 1 is a key regulator in A?-induced mitochondrial disruption and pathogenesis of Alzheimer's disease.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24906005 2014 CRIF1 deficiency induces p66shc-mediated oxidative stress and endothelial activation.
24520316 2014 CRIF1 interacting with CDK2 regulates bone marrow microenvironment-induced G0/G1 arrest of leukemia cells.
24103312 2014 Mechanism of androgen receptor corepression by CK?BP2/CRIF1, a multifunctional transcription factor coregulator expressed in prostate cancer.
More...