Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.53
PubTator Score 12.60

Knowledge Summary

Patent (1,909)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.700 0.001
ependymoma -1.800 0.002
oligodendroglioma -1.800 0.001
glioblastoma multiforme -1.200 0.000
group 3 medulloblastoma -1.500 0.037
primitive neuroectodermal tumor -1.300 0.024
adrenocortical carcinoma -1.150 0.009
adult high grade glioma -1.100 0.032
pilocytic astrocytoma -1.400 0.001
psoriasis 1.900 0.000

Synonym

Accession Q8TAE7 Q53SC1
Symbols KV6.3
KV10.1

Gene

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available

Gene RIF (4)

PMID Text
26530050 the correlation between dismal prognosis and Kv10.1 expression to patients with brain metastases or glioblastoma multiforme and, moreover, they strongly suggest a role of tricyclic antidepressants for personalized therapy of brain malignancies.
22204340 [review] an overview of the current status of data linking K(V)10.1 to cancer, and techniques that could exploit K(V)10.1's properties for the management of cancer
12060745 Obligatory heterotetramerization of three previously uncharacterized Kv channel subunits identified in human genome (Kv6.3)(Kv10.1) (Kv11.1)
11852086 These results indicate that Kv6.3 is a novel member of the voltage-gated K(+) channel which functions as a modulatory subunit of the Kv2.1 channel.

AA Sequence

MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAF      1 - 70
GFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMSDTYTFYSADEPGVLGRDEA     71 - 140
RPGGAEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVFVIVSMVVLCASTLPDWRNAAADNRSLDDRS    141 - 210
RYSAGPGREPSGIIEAICIGWFTAECIVRFIVSKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQ    211 - 280
LQRAGVTLRVLRMMRIFWVIKLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDL    281 - 350
ETSNKDFTSIPAACWWVIISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELK    351 - 420
FRSARYSRSLSTEFLN                                                          421 - 436
//

Text Mined References (11)

PMID Year Title
26530050 2015 Analysis of the expression of Kv10.1 potassium channel in patients with brain metastases and glioblastoma multiforme: impact on survival.
22204340 2012 Approaches targeting K(V)10.1 open a novel window for cancer diagnosis and therapy.
19074135 2009 Mutation of histidine 105 in the T1 domain of the potassium channel Kv2.1 disrupts heteromerization with Kv6.3 and Kv6.4.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15046870 2004 Modification of Kv2.1 K+ currents by the silent Kv10 subunits.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12060745 2002 Obligatory heterotetramerization of three previously uncharacterized Kv channel alpha-subunits identified in the human genome.
More...