Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
Funding $1,852,034.18
PubMed Score 16.89
PubTator Score 41.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.100 0.001
osteosarcoma 1.650 0.007
medulloblastoma -1.900 0.008
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -2.400 0.000
Pick disease -1.100 0.009
Breast cancer -2.600 0.000
ulcerative colitis -1.400 0.007
ovarian cancer 1.900 0.000
chronic rhinosinusitis -1.669 0.023
facioscapulohumeral dystrophy 2.200 0.005

Gene RIF (5)

PMID Text
20592344 analysis of antibodies generated against the protein phosphatase 1 inhibitor KEPI and characterization of the epitope
19475667 Observational study of gene-disease association. (HuGE Navigator)
19132087 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
11812771 regulation by morphine
11812771 PPP1R14C gene encodes a PKC-potentiated inhibitory protein, KEPI, for type-1 Ser/Thr protein phosphatase (PP1). KEPI mRNA and protein were enriched in brain, heart and skeletal muscle.

AA Sequence

MSVATGSSETAGGASGGGARVFFQSPRGGAGGSPGSSSGSGSSREDSAPVATAAAAGQVQQQQQRRHQQG      1 - 70
KVTVKYDRKELRKRLVLEEWIVEQLGQLYGCEEEEMPEVEIDIDDLLDADSDEERASKLQEALVDCYKPT     71 - 140
EEFIKELLSRIRGMRKLSPPQKKSV                                                 141 - 165
//

Text Mined References (18)

PMID Year Title
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21269460 2011 Initial characterization of the human central proteome.
20592344 2010 Generation of an antibody against the protein phosphatase 1 inhibitor KEPI and characterization of the epitope.
19475667 2009 SNCA variants are associated with increased risk for multiple system atrophy.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19132087 2009 A genome-wide association study identifies novel and functionally related susceptibility Loci for Kawasaki disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...