Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.98
PubTator Score 41.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.100 1.1e-03
atypical teratoid / rhabdoid tumor -1.700 1.5e-06
Breast cancer -2.600 2.3e-08
chronic rhinosinusitis -1.669 2.3e-02
facioscapulohumeral dystrophy 2.200 4.7e-03
group 3 medulloblastoma -1.700 1.4e-02
medulloblastoma, large-cell -2.400 1.2e-05
osteosarcoma 1.650 6.9e-03
ovarian cancer 1.900 2.1e-05
Pick disease -1.100 9.4e-03
ulcerative colitis -1.400 6.7e-03

Gene RIF (5)

AA Sequence

MSVATGSSETAGGASGGGARVFFQSPRGGAGGSPGSSSGSGSSREDSAPVATAAAAGQVQQQQQRRHQQG      1 - 70
KVTVKYDRKELRKRLVLEEWIVEQLGQLYGCEEEEMPEVEIDIDDLLDADSDEERASKLQEALVDCYKPT     71 - 140
EEFIKELLSRIRGMRKLSPPQKKSV                                                 141 - 165
//

Text Mined References (18)

PMID Year Title