Property Summary

NCBI Gene PubMed Count 27
Grant Count 5
R01 Count 5
Funding $2,029,465
PubMed Score 16.25
PubTator Score 13.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma -1.300 0.009
psoriasis -1.200 0.000
osteosarcoma -1.677 0.000
tuberculosis and treatment for 6 months 1.600 0.000

Gene RIF (9)

PMID Text
23932364 Involvement of SNIP1 in progression of lung cancer by regulating the RB/HDAC1 interaction.
22279524 Study identified sequence variants in the known disease-causing genes SLC6A3 and FLVCR1, and present evidence to strongly support the pathogenicity of variants identified in TUBGCP6, BRAT1, SNIP1, CRADD, and HARS.
22020748 SNIP1 in cells strongly activated the heat shock element signaling pathway, and SNIP1 might selectively regulate the transcription of some heat shock proteins through associating with heat shock elements
21167768 overexpression of HIF-1alpha, TWIST2 or SNIP1 correlated with poor disease-free survival in patients with tongue squamous cell carcinoma
18794151 Study shows a novel mechanism regulating Cyclin D1 expression and offers new insight into the role of SNIP1 and associated proteins as regulators of proliferation and cancer.
18632581 SNIP1, the human homolog of DDL, is involved in miRNA biogenesis and interacts with Drosha
17157259 SNIP1 functions as a regulator of c-Myc activity, binding the N c-Myc N terminus through its C terminus, and that SNIP1 enhances the transcriptional activity of c-Myc by stabilizing it against proteosomal degradation and bridging the c-Myc/p300 complex.
15750622 Smad-binding peptide aptamers can be developed to selectively inhibit TGF-beta-induced gene expression.
15378006 define both a new function for SNIP1 and identify a previously unrecognized regulator of the cell cycle and cyclin D1 expression

AA Sequence

MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARSGHRGNRA      1 - 70
RGVSRSPPKKKNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGREDRQHREPSEQEHRRARNSDR     71 - 140
DRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGGGSESQELVPRPG    141 - 210
GNNKEKEVPAKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSA    211 - 280
YLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYY    281 - 350
ELKEKDVLKFGFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS                            351 - 396
//

Text Mined References (39)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23932364 2013 High expression of SNIP1 correlates with poor prognosis in non-small cell lung cancer and SNIP1 interferes with the recruitment of HDAC1 to RB in vitro.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...