| Tbio | Smad nuclear-interacting protein 1 |
Down-regulates NF-kappa-B signaling by competing with RELA for CREBBP/EP300 binding. Involved in the microRNA (miRNA) biogenesis. May be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA.
This gene encodes a protein that contains a coiled-coil motif and C-terminal forkhead-associated (FHA) domain. The encoded protein functions as a transcriptional coactivator that increases c-Myc activity and inhibits transforming growth factor beta (TGF-beta) and nuclear factor kappa-B (NF-kB) signaling. The encoded protein also regulates the stability of cyclin D1 mRNA, and may play a role in cell proliferation and cancer progression. Mutations in this gene are a cause of psychomotor retardation, epilepsy, and craniofacial dysmorphism (PMRED). [provided by RefSeq, Mar 2012]
This gene encodes a protein that contains a coiled-coil motif and C-terminal forkhead-associated (FHA) domain. The encoded protein functions as a transcriptional coactivator that increases c-Myc activity and inhibits transforming growth factor beta (TGF-beta) and nuclear factor kappa-B (NF-kB) signaling. The encoded protein also regulates the stability of cyclin D1 mRNA, and may play a role in cell proliferation and cancer progression. Mutations in this gene are a cause of psychomotor retardation, epilepsy, and craniofacial dysmorphism (PMRED). [provided by RefSeq, Mar 2012]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| osteosarcoma | 7933 | 6.97343040473185E-7 |
| tuberculosis and treatment for 6 months | 686 | 1.12854970085186E-4 |
| psoriasis | 6685 | 1.53762609019199E-4 |
| oligodendroglioma | 2849 | 0.00892761908731318 |
| Disease | Target Count |
|---|---|
| Psychomotor retardation, epilepsy, and craniofacial dysmorphism | 1 |
| Disease | log2 FC | p |
|---|---|---|
| oligodendroglioma | -1.300 | 0.009 |
| psoriasis | -1.200 | 0.000 |
| osteosarcoma | -1.677 | 0.000 |
| tuberculosis and treatment for 6 months | 1.600 | 0.000 |
| Species | Source |
|---|---|
| Chimp | OMA EggNOG |
| Mouse | OMA EggNOG Inparanoid |
| Rat | OMA EggNOG |
| Dog | OMA EggNOG Inparanoid |
| Cow | OMA EggNOG Inparanoid |
| Opossum | OMA EggNOG Inparanoid |
| Chicken | OMA EggNOG Inparanoid |
| Anole lizard | OMA EggNOG Inparanoid |
| Xenopus | OMA EggNOG Inparanoid |
| C. elegans | EggNOG Inparanoid |
| Fruitfly | EggNOG Inparanoid |
| PMID | Text |
|---|---|
| 23932364 | Involvement of SNIP1 in progression of lung cancer by regulating the RB/HDAC1 interaction. |
| 22279524 | Study identified sequence variants in the known disease-causing genes SLC6A3 and FLVCR1, and present evidence to strongly support the pathogenicity of variants identified in TUBGCP6, BRAT1, SNIP1, CRADD, and HARS. |
| 22020748 | SNIP1 in cells strongly activated the heat shock element signaling pathway, and SNIP1 might selectively regulate the transcription of some heat shock proteins through associating with heat shock elements |
| 21167768 | overexpression of HIF-1alpha, TWIST2 or SNIP1 correlated with poor disease-free survival in patients with tongue squamous cell carcinoma |
| 18794151 | Study shows a novel mechanism regulating Cyclin D1 expression and offers new insight into the role of SNIP1 and associated proteins as regulators of proliferation and cancer. |
| 18632581 | SNIP1, the human homolog of DDL, is involved in miRNA biogenesis and interacts with Drosha |
| 17157259 | SNIP1 functions as a regulator of c-Myc activity, binding the N c-Myc N terminus through its C terminus, and that SNIP1 enhances the transcriptional activity of c-Myc by stabilizing it against proteosomal degradation and bridging the c-Myc/p300 complex. |
| 15750622 | Smad-binding peptide aptamers can be developed to selectively inhibit TGF-beta-induced gene expression. |
| 15378006 | define both a new function for SNIP1 and identify a previously unrecognized regulator of the cell cycle and cyclin D1 expression |
MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARSGHRGNRA 1 - 70 RGVSRSPPKKKNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGREDRQHREPSEQEHRRARNSDR 71 - 140 DRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGGGSESQELVPRPG 141 - 210 GNNKEKEVPAKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSA 211 - 280 YLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYY 281 - 350 ELKEKDVLKFGFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS 351 - 396 //
| PMID | Year | Title |
|---|---|---|
| 25772364 | 2015 | SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage. |
| 25755297 | 2015 | System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability. |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. |
| 25218447 | 2014 | Uncovering global SUMOylation signaling networks in a site-specific manner. |
| 25114211 | 2014 | Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli. |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
| 24270810 | 2013 | High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy. |
| 24144296 | 2013 | Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error. |
| 23932364 | 2013 | High expression of SNIP1 correlates with poor prognosis in non-small cell lung cancer and SNIP1 interferes with the recruitment of HDAC1 to RB in vitro. |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
| More... |
