Property Summary

NCBI Gene PubMed Count 28
PubMed Score 16.61
PubTator Score 13.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 7.0e-07
tuberculosis and treatment for 6 months 409 1.1e-04
psoriasis 6694 1.5e-04
oligodendroglioma 2850 8.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma -1.300 8.9e-03
osteosarcoma -1.677 7.0e-07
psoriasis -1.200 1.5e-04
tuberculosis and treatment for 6 months 1.600 1.1e-04

Gene RIF (10)

AA Sequence

MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARSGHRGNRA      1 - 70
RGVSRSPPKKKNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGREDRQHREPSEQEHRRARNSDR     71 - 140
DRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGGGSESQELVPRPG    141 - 210
GNNKEKEVPAKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSA    211 - 280
YLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYY    281 - 350
ELKEKDVLKFGFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS                            351 - 396
//

Text Mined References (41)

PMID Year Title