Property Summary

NCBI Gene PubMed Count 8
PubMed Score 39.29
PubTator Score 23.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ovarian cancer 1.500 2.4e-02
active ulcerative colitis 1.195 3.0e-02
adrenocortical carcinoma 1.377 5.0e-02
chronic lymphosyte leukemia -2.000 7.5e-13
fascioscapulohumeral muscular dystrophy 1.491 2.2e-04
group 3 medulloblastoma 1.400 1.9e-02
interstitial cystitis 1.400 5.0e-03
intraductal papillary-mucinous neoplasm ... 1.400 3.0e-02
non-small cell lung cancer 1.118 2.8e-05
oligodendroglioma -1.800 4.1e-02
osteosarcoma 2.346 2.8e-04
pituitary cancer 2.300 4.4e-05
primary Sjogren syndrome 1.300 1.4e-03
psoriasis 1.200 2.6e-25

Gene RIF (1)

AA Sequence

MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN             1 - 63
//

Text Mined References (10)

PMID Year Title