Property Summary

NCBI Gene PubMed Count 7
PubMed Score 36.29
PubTator Score 23.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.91451750412444E-61
chronic lymphosyte leukemia 232 7.53104897941794E-13
non-small cell lung cancer 2798 2.75051866502606E-5
pituitary cancer 1972 4.39746115872211E-5
fascioscapulohumeral muscular dystrophy 100 2.18061464519222E-4
osteosarcoma 7933 2.84669451539094E-4
primary Sjogren syndrome 789 0.00135767565185103
interstitial cystitis 2299 0.00500482481697706
group 3 medulloblastoma 2254 0.0187523545397779
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0298987912226831
active ulcerative colitis 477 0.0300481036920637
oligodendroglioma 2849 0.0410484164968589
adrenocortical carcinoma 1427 0.0496863503487022
Disease Target Count Z-score Confidence
Spondylosis 13 3.641 1.8
ovarian cancer 8492 3.532 1.8

Expression

  Differential Expression (14)

AA Sequence

MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN             1 - 63
//

Text Mined References (9)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
23419831 2014 APOE and BCHE as modulators of cerebral amyloid deposition: a florbetapir PET genome-wide association study.
22935015 2013 A novel transcript is up-regulated by fasting in the hypothalamus and enhances insulin signalling.
19531736 2009 Transcripts of unknown function in multiple-signaling pathways involved in human stem cell differentiation.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11890990 2002 Cloning of the mRNA of overexpression in colon carcinoma-1: a sequence overexpressed in a subset of colon carcinomas.