Property Summary

NCBI Gene PubMed Count 10
Grant Count 12
R01 Count 10
Funding $932,505.5
PubMed Score 14.59
PubTator Score 8.71

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
24794441 Utilizing gene microarray analysis, authors found the cytokine interleukin 17D (IL-17D) was highly expressed in certain unedited tumors.
23490420 These experiments were designed to investigate the effects of IL-17 upon the phenotype and function of human Natural Killer (NK) cells.
22156348 IL-27 priming results in enhanced lipopolysaccharide-induced IL-6, tumor necrosis factor (TNF)-alpha, macrophage inflammatory protein (MIP)-1alpha, and MIP-1beta expression in human primary monocytes.
20237496 Observational study of gene-disease association. (HuGE Navigator)
12097364 IL-17D stimulates production of cytokines in endothelial cells in vitro and suppresses proliferation of myeloid progenitors in colony formation assays.

AA Sequence

MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNAS      1 - 70
CPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPT     71 - 140
VVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP            141 - 202
//

Text Mined References (12)

PMID Year Title
24850809 2014 Genetic determinants of P wave duration and PR segment.
24794441 2014 Interleukin-17D mediates tumor rejection through recruitment of natural killer cells.
23490420 2013 The effects of IL-17 upon human natural killer cells.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22156348 2012 IL-27 enhances LPS-induced proinflammatory cytokine production via upregulation of TLR4 expression and signaling in human monocytes.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...