Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.12
PubTator Score 3.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.300 2.5e-04
Astrocytoma, Pilocytic -1.200 1.9e-06
atypical teratoid / rhabdoid tumor -1.800 6.7e-07
ependymoma -1.800 8.8e-19
glioblastoma -1.400 2.7e-08
group 3 medulloblastoma -1.500 3.6e-04
lung adenocarcinoma 1.100 1.7e-05
lung carcinoma 2.600 1.2e-42
medulloblastoma, large-cell -1.200 2.3e-04
pancreatic cancer -1.300 1.0e-03
primary pancreatic ductal adenocarcinoma -1.359 3.7e-04
subependymal giant cell astrocytoma -1.819 1.4e-02
ulcerative colitis 1.157 4.9e-02

Gene RIF (3)

AA Sequence

MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHVSMTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATN      1 - 70
FGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISF     71 - 140
FGTNIGSAVVMLIPTVMFTVMAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMG    141 - 210
AAQGAMNQPQTQYSATPNYTYSNEM                                                 211 - 235
//

Text Mined References (16)

PMID Year Title