Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.28
PubTator Score 3.51

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
20071347 scanp5 is predicted to play a role in neuronal vesicle trafficking and be involed in autism
19240033 exposure to ER stress increases SCAMP5 in the striatum, which positively regulates mtHTT aggregation via the endocytosis pathway
19234194 SCAMP5 is involved in calcium-regulated exocytosis of signal peptide-containing cytokines, in cooperation with the SNARE machinery of secretory vesicles.

AA Sequence

MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHVSMTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATN      1 - 70
FGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISF     71 - 140
FGTNIGSAVVMLIPTVMFTVMAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMG    141 - 210
AAQGAMNQPQTQYSATPNYTYSNEM                                                 211 - 235
//

Text Mined References (16)

PMID Year Title
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
21490707 2011 Genome-wide meta-analysis identifies regions on 7p21 (AHR) and 15q24 (CYP1A2) as determinants of habitual caffeine consumption.
20071347 2010 SCAMP5, NBEA and AMISYN: three candidate genes for autism involved in secretion of large dense-core vesicles.
19240033 2009 SCAMP5 links endoplasmic reticulum stress to the accumulation of expanded polyglutamine protein aggregates via endocytosis inhibition.
19234194 2009 Human SCAMP5, a novel secretory carrier membrane protein, facilitates calcium-triggered cytokine secretion by interaction with SNARE machinery.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15840657 2005 Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...