Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.43
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDV      1 - 70
NVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLD     71 - 140
SKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD                          141 - 188
//