Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.5e-08
acute myeloid leukemia 783 8.7e-03

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -1.200 8.7e-03
osteosarcoma -3.841 5.5e-08

AA Sequence

MNLDGSAQDPEKREYSSVCVGREDDIKKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIE      1 - 70
DFDGRPCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGIKQRIHTVTVDNGNIYVTLSNEPFKC     71 - 140
DSDFYATGDFKVIKSSS                                                         141 - 157
//

Text Mined References (8)

PMID Year Title