Property Summary

NCBI Gene PubMed Count 22
PubMed Score 0.00
PubTator Score 4.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Glioma 74 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.1e-04
Disease Target Count Z-score Confidence
Malignant glioma 26 4.513 2.3

Synonym

Accession Q8TAB7
Symbols RAM

Gene

 Compartment GO Term (0)

Gene RIF (16)

AA Sequence

MERLCLQPGLLPTAVYLPHWERSSRDREEKEAPFFRLLSRRLMFCVHARQRTQNVPINKYQRLVVKMKEE      1 - 70
EALREKLNMQNITHKENQNAGSLEMIDNMLKQEERRELK                                    71 - 109
//

Text Mined References (23)

PMID Year Title