Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.00
PubTator Score 4.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (15)

PMID Text
26505354 Meta-analysis suggests that the rs4295627 SNP is associated with an increased risk of glioma.
26014354 Single nucleotide polymorphisms in CDKN2BAS are associated with increased susceptibility to pediatric brain tumors.
25928165 CCDC26 controls growth of myeloid leukemia cells through regulation of KIT expression.
25928165 CCDC26 controls growth of myeloid leukemia cells through regulation of KIT expression. CCDC26 knockdown in K562 cells results in lowered growth in medium with high concentration of serum and inhibition of apoptosis in serum depleted medium. Activation of KIT expression in KD cells was observed. A tyrosine kinase inhibitor specific to KIT eliminated these effects.
25245984 our study identified novel PVT1-NSMCE2 and CCDC26-NSMCE2 fusion genes that may play functional roles in leukemia.
24870769 Study found rs891835 in CCDC26 to be associated with glioblastoma susceptibility in a Han Chinese population.
22369735 we found three protective alleles for glioma patients, including the allele ''G'' of rs6470745 in CCDC26 gene by recessive model analysis
22116548 Genetic polymorphism of CCDC26 is associated with myeloid malignancies with mutant IDH1 and IDH2 differentially.
21920947 (rs4295627, a genetic variant of CCDC26 was one of 3 genetic variants implicated in a pool of US epidemiologic studies of glioma risk
20847058 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MERLCLQPGLLPTAVYLPHWERSSRDREEKEAPFFRLLSRRLMFCVHARQRTQNVPINKYQRLVVKMKEE      1 - 70
EALREKLNMQNITHKENQNAGSLEMIDNMLKQEERRELK                                    71 - 109
//

Text Mined References (21)

PMID Year Title
26505354 2015 CCDC26 rs4295627 polymorphism (8q24.21) and glioma risk: a meta-analysis.
26014354 2015 CCDC26, CDKN2BAS, RTEL1 and TERT Polymorphisms in pediatric brain tumor susceptibility.
25928165 2015 Long noncoding RNA, CCDC26, controls myeloid leukemia cell growth through regulation of KIT expression.
25245984 2014 8q24 amplified segments involve novel fusion genes between NSMCE2 and long noncoding RNAs in acute myelogenous leukemia.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24870769 2014 CCDC26 gene polymorphism and glioblastoma risk in the Han Chinese population.
23399484 2013 Deciphering the 8q24.21 association for glioma.
22369735 2012 Polymorphisms of TREH, IL4R and CCDC26 genes associated with risk of glioma.
22116548 2012 Differential distribution of CCDC26 glioma-risk alleles in myeloid malignancies with mutant IDH1 compared with their IDH2R140-mutated or IDH-unmutated counterparts.
21920947 2011 Joint associations between genetic variants and reproductive factors in glioma risk among women.
More...