Property Summary

NCBI Gene PubMed Count 33
PubMed Score 76.52
PubTator Score 32.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.300 2.0e-04
Astrocytoma, Pilocytic 1.600 1.4e-08
atypical teratoid / rhabdoid tumor 2.500 3.1e-10
Breast cancer 1.300 5.3e-11
ependymoma 1.100 6.9e-03
glioblastoma 1.700 1.8e-06
group 3 medulloblastoma 1.800 2.4e-04
interstitial cystitis -1.100 6.6e-04
medulloblastoma, large-cell 1.200 1.3e-03
non-small cell lung cancer 1.148 5.8e-16
osteosarcoma 2.583 6.6e-06
ovarian cancer 1.600 4.6e-06
primitive neuroectodermal tumor 1.300 2.9e-03
subependymal giant cell astrocytoma 1.213 4.7e-02

Gene RIF (26)

AA Sequence

MDTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDD      1 - 70
NWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPILWRD     71 - 140
ELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILD    141 - 210
SRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVL    211 - 280
ENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEH    281 - 350
ERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSM    351 - 420
ESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIVFVLKCLDFSL    421 - 490
VVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV                                        491 - 524
//

Text Mined References (37)

PMID Year Title