Property Summary

NCBI Gene PubMed Count 29
PubMed Score 72.18
PubTator Score 32.53

Knowledge Summary


No data available



Accession Q8TAA9 Q5T1D3 Q5T1D4 Q86WG8 Q8N559
Symbols LPP2


  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (24)

26914375 We first propose the use of a DNA biosensor to detect the missense single nucleotide polymorphism (rs4839469 c.346G>A p.Ala116Thr) of the vangl1 gene
26735870 a novel and ultrasensitive sandwich-type immunosensor was fabricated to detect Vangl in human serum using C60-templated AuPt as labels and rGO-TEPA-PTC-NH2 as the platform.
26496979 Results found that KITENIN is associated with tumor progression by enhancing angiogenesis in colorectal cancer.
25874746 Authors silenced VANGL1 gene expression in the HepG2 HCC cell line by stable transfection with a vector containing siRNA template for VANGL1 and investigated the change in cell invasion and motility.
25605251 High levels of KITENIN increased glioma invasiveness and progression, and are associated with the up-regulation of EMT and stemness markers.
25208524 VANGL1 mutations are associated with neural tube defects.
25068569 These results strongly suggest that R181 and R274 play critical roles in Vangl protein function and that their mutations cause neural tube defects in humans.
24909917 Findings identify that KITENIN-targeting miR-124, miR-27a, and miR-30b function as endogenous inhibitors of colorectal cancer cell motility and demonstrate that miR-124 plays a suppressor role in colorectal tumorigenesis.
24893630 Elevated KITENIN expression is associated with drug resistance in colorectal cancer.
24452931 The results show that the Vangl1 amino terminus lacks PM targeting determinants, and these are restricted to the carboxy terminus, including the predicted PDZBM motif at the C-terminus

AA Sequence

VVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV                                        491 - 524

Text Mined References (33)

PMID Year Title
26914375 2016 A novel DNA biosensor integrated with Polypyrrole/streptavidin and Au-PAMAM-CP bionanocomposite probes to detect the rs4839469 locus of the vangl1 gene for dysontogenesis prediction.
26735870 2016 A novel electrochemical immunosensor based on the rGO-TEPA-PTC-NH? and AuPt modified C?? bimetallic nanoclusters for the detection of Vangl1, a potential biomarker for dysontogenesis.
26496979 2016 Impact of KITENIN on tumor angiogenesis and lymphangiogenesis in colorectal cancer.
25874746 2015 Downregulation of VANGL1 inhibits cellular invasion rather than cell motility in hepatocellular carcinoma cells without stimulation.
25605251 2015 KITENIN promotes glioma invasiveness and progression, associated with the induction of EMT and stemness markers.
25208524 2015 Expanding the mutational spectrum associated to neural tube defects: literature revision and description of novel VANGL1 mutations.
25068569 2014 Independent mutations at Arg181 and Arg274 of Vangl proteins that are associated with neural tube defects in humans decrease protein stability and impair membrane targeting.
24909917 2014 KITENIN-targeting microRNA-124 suppresses colorectal cancer cell motility and tumorigenesis.
24893630 2014 An unconventional KITENIN/ErbB4-mediated downstream signal of EGF upregulates c-Jun and the invasiveness of colorectal cancer cells.
24452931 2014 The intracellular carboxyl terminal domain of Vangl proteins contains plasma membrane targeting signals.