Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.14
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.304 0.000
psoriasis 1.200 0.001

Synonym

Accession Q8TAA3 B0YJ75 Q8IVP4 Q8TA98 Q8TAA2
Symbols PSMA7L

Gene

 GWAS Trait (1)

Gene RIF (1)

PMID Text
12376572 This article provides an overview of some of the components in the human 20 S proteasome.

AA Sequence

MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALDDH      1 - 70
VCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISAL     71 - 140
IVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAIASDSEAIKLAIKALLEVVQSG    141 - 210
GKNIELAIIRRNQPLKMFSAKEVELYVTEIEKEKEEAEKKKSKKSV                            211 - 256
//

Text Mined References (10)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376572 2002 Mapping and structural dissection of human 20 S proteasome using proteomic approaches.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.