Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.14
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.3e-04
psoriasis 6694 9.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.304 1.3e-04
psoriasis 1.200 9.6e-04

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALDDH      1 - 70
VCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISAL     71 - 140
IVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAIASDSEAIKLAIKALLEVVQSG    141 - 210
GKNIELAIIRRNQPLKMFSAKEVELYVTEIEKEKEEAEKKKSKKSV                            211 - 256
//

Text Mined References (10)

PMID Year Title