Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.57
PubTator Score 0.50

Knowledge Summary

Patent

No data available

AA Sequence

METFPLLLLSLGLVLAEASESTMKIIKEEFTDEEMQYDMAKSGQEKQTIEILMNPILLVKNTSLSMSKDD      1 - 70
MSSTLLTFRSLHYNDPKGNSSGNDKECCNDMTVWRKVSEANGSCKWSNNFIRSSTEVMRRVHRAPSCKFV     71 - 140
QNPGISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWLVCGSKL               141 - 199
//

Text Mined References (6)

PMID Year Title
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
15676279 2005 The ribonuclease A superfamily of mammals and birds: identifying new members and tracing evolutionary histories.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.