Property Summary

NCBI Gene PubMed Count 36
PubMed Score 32.35
PubTator Score 34.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.004 7.9e-03
adrenocortical carcinoma 1.407 1.6e-03
adult high grade glioma 1.400 1.8e-04
Atopic dermatitis 1.500 3.6e-04
atypical teratoid / rhabdoid tumor 2.400 2.1e-06
Breast cancer 1.300 2.9e-06
colon cancer 2.300 1.8e-03
ependymoma 1.500 1.4e-08
glioblastoma 2.000 8.9e-08
group 3 medulloblastoma 2.700 4.0e-05
lung cancer 2.800 2.3e-04
medulloblastoma, large-cell 2.300 1.6e-06
nasopharyngeal carcinoma 1.300 6.7e-04
non-small cell lung cancer 1.319 3.1e-15
ovarian cancer 1.200 5.3e-04
primitive neuroectodermal tumor 2.500 8.5e-06
psoriasis 1.700 2.2e-90

 GWAS Trait (1)

Gene RIF (21)

AA Sequence

MSVTEEDLCHHMKVVVRVRPENTKEKAAGFHKVVHVVDKHILVFDPKQEEVSFFHGKKTTNQNVIKKQNK      1 - 70
DLKFVFDAVFDETSTQSEVFEHTTKPILRSFLNGYNCTVLAYGATGAGKTHTMLGSADEPGVMYLTMLHL     71 - 140
YKCMDEIKEEKICSTAVSYLEVYNEQIRDLLVNSGPLAVREDTQKGVVVHGLTLHQPKSSEEILHLLDNG    141 - 210
NKNRTQHPTDMNATSSRSHAVFQIYLRQQDKTASINQNVRIAKMSLIDLAGSERASTSGAKGTRFVEGTN    211 - 280
INRSLLALGNVINALADSKRKNQHIPYRNSKLTRLLKDSLGGNCQTIMIAAVSPSSVFYDDTYNTLKYAN    281 - 350
RAKDIKSSLKSNVLNVNNHITQYVKICNEQKAEILLLKEKLKAYEEQKAFTNENDQAKLMISNPQEKEIE    351 - 420
RFQEILNCLFQNREEIRQEYLKLEMLLKENELKSFYQQQCHKQIEMMCSEDKVEKATGKRDHRLAMLKTR    421 - 490
RSYLEKRREEELKQFDENTNWLHRVEKEMGLLSQNGHIPKELKKDLHCHHLHLQNKDLKAQIRHMMDLAC    491 - 560
LQEQQHRQTEAVLNALLPTLRKQYCTLKEAGLSNAAFESDFKEIEHLVERKKVVVWADQTAEQPKQNDLP    561 - 630
GISVLMTFPQLGPVQPIPCCSSSGGTNLVKIPTEKRTRRKLMPSPLKGQHTLKSPPSQSVQLNDSLSKEL    631 - 700
QPIVYTPEDCRKAFQNPSTVTLMKPSSFTTSFQAISSNINSDNCLKMLCEVAIPHNRRKECGQEDLDSTF    701 - 770
TICEDIKSSKCKLPEQESLPNDNKDILQRLDPSSFSTKHSMPVPSMVPSYMAMTTAAKRKRKLTSSTSNS    771 - 840
SLTADVNSGFAKRVRQDNSSEKHLQENKPTMEHKRNICKINPSMVRKFGRNISKGNLR                841 - 898
//

Text Mined References (43)

PMID Year Title