Property Summary

NCBI Gene PubMed Count 33
Grant Count 13
R01 Count 9
Funding $1,037,636.5
PubMed Score 29.55
PubTator Score 34.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (19)

PMID Text
25884224 Confocal microscopy shows that cells expressing SUMO-resistant Kif18A display a compromised dissociation of BubR1 from kinetochores after anaphase onset.
25431949 a biomarker for hepatocellular carcinoma diagnosis and an independent predictor of overall survival
25281536 that the human mitotic kinesin-8, KIF18A, directly interacts with PP1gamma through a conserved RVxF motif
25208566 data support a model in which microtubule-attenuating kinesins are molecularly "tuned" to control the dynamics of specific subsets of spindle microtubules
25048371 Cdk1-mediated inhibitory phosphorylation of Kif18A promotes chromosome oscillations in early metaphase. PP1 induces metaphase plate thinning by directly dephosphorylating Kif18A.
23746518 the motion of yeast (Kip3) and human (Kif18A) kinesin-8s
23288039 Mechanisms controlling the temporal degradation of Nek2A and Kif18A by the APC/C-Cdc20 complex.
22595673 Kif18A (kinesin-8) attenuates centromere movement by directly promoting microtubule pausing in a concentration- dependent manner.
22104080 there is a mutual regulation of kinetochore MT plus-end dynamics and Kif18A accumulation, which may contribute to the highly regulated and ordered changes in kinetochore spindle microtubule dynamics during chromosome congression and oscillation
21885282 Kif18A controls spindle length independently of its role in chromosome positioning. This is mediated by an ATP-independent spindle microtubule (MT) binding site at C-terminal end of the Kif18A tail that has a strong affinity for MTs in vitro and in cells.
More...

AA Sequence

MSVTEEDLCHHMKVVVRVRPENTKEKAAGFHKVVHVVDKHILVFDPKQEEVSFFHGKKTTNQNVIKKQNK      1 - 70
DLKFVFDAVFDETSTQSEVFEHTTKPILRSFLNGYNCTVLAYGATGAGKTHTMLGSADEPGVMYLTMLHL     71 - 140
YKCMDEIKEEKICSTAVSYLEVYNEQIRDLLVNSGPLAVREDTQKGVVVHGLTLHQPKSSEEILHLLDNG    141 - 210
NKNRTQHPTDMNATSSRSHAVFQIYLRQQDKTASINQNVRIAKMSLIDLAGSERASTSGAKGTRFVEGTN    211 - 280
INRSLLALGNVINALADSKRKNQHIPYRNSKLTRLLKDSLGGNCQTIMIAAVSPSSVFYDDTYNTLKYAN    281 - 350
RAKDIKSSLKSNVLNVNNHITQYVKICNEQKAEILLLKEKLKAYEEQKAFTNENDQAKLMISNPQEKEIE    351 - 420
RFQEILNCLFQNREEIRQEYLKLEMLLKENELKSFYQQQCHKQIEMMCSEDKVEKATGKRDHRLAMLKTR    421 - 490
RSYLEKRREEELKQFDENTNWLHRVEKEMGLLSQNGHIPKELKKDLHCHHLHLQNKDLKAQIRHMMDLAC    491 - 560
LQEQQHRQTEAVLNALLPTLRKQYCTLKEAGLSNAAFESDFKEIEHLVERKKVVVWADQTAEQPKQNDLP    561 - 630
GISVLMTFPQLGPVQPIPCCSSSGGTNLVKIPTEKRTRRKLMPSPLKGQHTLKSPPSQSVQLNDSLSKEL    631 - 700
QPIVYTPEDCRKAFQNPSTVTLMKPSSFTTSFQAISSNINSDNCLKMLCEVAIPHNRRKECGQEDLDSTF    701 - 770
TICEDIKSSKCKLPEQESLPNDNKDILQRLDPSSFSTKHSMPVPSMVPSYMAMTTAAKRKRKLTSSTSNS    771 - 840
SLTADVNSGFAKRVRQDNSSEKHLQENKPTMEHKRNICKINPSMVRKFGRNISKGNLR                841 - 898
//

Text Mined References (39)

PMID Year Title
25884224 2015 Sumoylation of Kif18A plays a role in regulating mitotic progression.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25431949 2014 High KIF18A expression correlates with unfavorable prognosis in primary hepatocellular carcinoma.
25281536 2014 The human mitotic kinesin KIF18A binds protein phosphatase 1 (PP1) through a highly conserved docking motif.
25208566 2014 A unique kinesin-8 surface loop provides specificity for chromosome alignment.
25048371 2014 Pre-anaphase chromosome oscillations are regulated by the antagonistic activities of Cdk1 and PP1 on Kif18A.
23746518 2013 Kinesin-8 is a low-force motor protein with a weakly bound slip state.
23288039 2013 Mechanisms controlling the temporal degradation of Nek2A and Kif18A by the APC/C-Cdc20 complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22595673 2012 Kif18A and chromokinesins confine centromere movements via microtubule growth suppression and spatial control of kinetochore tension.
More...