Property Summary

NCBI Gene PubMed Count 21
PubMed Score 36.54
PubTator Score 17.92

Knowledge Summary

Patent (1,388)

Expression

  Differential Expression (11)

Disease log2 FC p
Amyotrophic lateral sclerosis -1.309 2.5e-04
astrocytoma 1.100 5.0e-02
atypical teratoid / rhabdoid tumor -1.100 5.6e-04
Duchenne muscular dystrophy -1.335 4.5e-04
ductal carcinoma in situ -1.400 2.2e-04
invasive ductal carcinoma -1.700 1.2e-03
juvenile dermatomyositis -1.328 5.0e-05
osteosarcoma -1.631 1.2e-03
pancreatic cancer -1.700 1.3e-04
pancreatic ductal adenocarcinoma liver m... -1.077 2.8e-02
psoriasis -1.100 2.5e-07

Gene RIF (10)

AA Sequence

MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAE      1 - 70
NFGGPEGEFHFSVPHAAGASTDFSSASAPDQSAPPSLGHAHSEGPAPAYVASGPFREAGFPGQASSPLGR     71 - 140
ANGRLFANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQTLSEHARERKVPVTR    141 - 210
IGRLANFGGLAVGLGFGALAEVAKKSLRSEDPSGKKAVLGSSPFLSEANAERIVRTLCKVRGAALKLGQM    211 - 280
LSIQDDAFINPHLAKIFERVRQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMK    281 - 350
GGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRD    351 - 420
LLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPN    421 - 490
WSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGYEVKVMEDAHL    491 - 560
DAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLVPPPEETYSLHRKMGGSFLICSKLKARFPCK    561 - 630
AMFEEAYSNYCKRQAQQ                                                         631 - 647
//

Text Mined References (31)

PMID Year Title