Property Summary

NCBI Gene PubMed Count 54
Grant Count 7
Funding $923,833.86
PubMed Score 41.11
PubTator Score 119.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.33 1.7
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 2.400 0.006

 GO Component (2)

Gene RIF (46)

PMID Text
26185996 BORIS is associated with cancer stem cell-enriched populations of several epithelial tumor cells and the different phenotypes depend on the origin of tumor cells.
26125810 Data found that BORIS and CTCF expression in low-grade squamous intraepithelial lesions and invasive cervical carcinoma is higher than in normal samples. The possible utility of BORIS and CTCF as biomarkers in cervical neoplasm requires further analysis.
25499215 In the first detailed analysis in cancer, a marked loss of CHD8 expression and increased BORIS/CTCF ratio indicate frequent disruption of CTCF and its effector genes in PCa.
25363021 Differential regulation of MAGE-A1 promoter activity by BORIS and Sp1, both interacting with the TATA binding protein.
24984200 results provide novel insights into the determinants of NOTCH3 overexpression in cancer cells, by revealing a key role for BORIS as the main mediator of transcriptional deregulation of NOTCH3
24983365 The serum levels of MAGE-A and BORIS mRNA, as well as let-7b were significantly higher in patients.
24658009 CTCFL/BORIS was amongst the top ranked genes differentially expressed between endometrioid and non-endometrioid tumors, and increasing mRNA level of CTCFL/BORIS was highly significantly associated with poor survival.
24563233 High BORIS transcript variants are associated with laryngeal squamous cell carcinomas.
24279897 BORIS is an RNA-binding protein that associates with polysomes.
24123052 The ability of BORIS to activate the androgen receptor gene indicates BORIS involvement in the growth and development of prostate tumors.
More...

AA Sequence

MAATEISVLSEQFTKIKELELMPEKGLKEEEKDGVCREKDHRSPSELEAERTSGAFQDSVLEEEVELVLA      1 - 70
PSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQ     71 - 140
ELYSPQEMEVLQFHALEENVMVASEDSKLAVSLAETTGLIKLEEEQEKNQLLAERTKEQLFFVETMSGDE    141 - 210
RSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHT    211 - 280
SEKPHLCHLCLKTFRTVTLLRNHVNTHTGTRPYKCNDCNMAFVTSGELVRHRRYKHTHEKPFKCSMCKYA    281 - 350
SVEASKLKRHVRSHTGERPFQCCQCSYASRDTYKLKRHMRTHSGEKPYECHICHTRFTQSGTMKIHILQK    351 - 420
HGENVPKYQCPHCATIIARKSDLRVHMRNLHAYSAAELKCRYCSAVFHERYALIQHQKTHKNEKRFKCKH    421 - 490
CSYACKQERHMTAHIRTHTGEKPFTCLSCNKCFRQKQLLNAHFRKYHDANFIPTVYKCSKCGKGFSRWIN    491 - 560
LHRHSEKCGSGEAKSAASGKGRRTRKRKQTILKEATKGQKEAAKGWKEAANGDEAAAEEASTTKGEQFPG    561 - 630
EMFPVACRETTARVKEEVDEGVTCEMLLNTMDK                                         631 - 663
//

Text Mined References (56)

PMID Year Title
26185996 2015 Different Effects of BORIS/CTCFL on Stemness Gene Expression, Sphere Formation and Cell Survival in Epithelial Cancer Stem Cells.
26125810 2015 BORIS and CTCF are overexpressed in squamous intraepithelial lesions and cervical cancer.
25499215 2014 Frequent disruption of chromodomain helicase DNA-binding protein 8 (CHD8) and functionally associated chromatin regulators in prostate cancer.
25363021 2014 Differential regulation of MAGE-A1 promoter activity by BORIS and Sp1, both interacting with the TATA binding protein.
24984200 2014 The epigenetic factor BORIS/CTCFL regulates the NOTCH3 gene expression in cancer cells.
24983365 2014 Circulating cell-free cancer-testis MAGE-A RNA, BORIS RNA, let-7b and miR-202 in the blood of patients with breast cancer and benign breast diseases.
24658009 2014 Hypomethylation of the CTCFL/BORIS promoter and aberrant expression during endometrial cancer progression suggests a role as an Epi-driver gene.
24563233 2014 Possible prognostic value of BORIS transcript variants ratio in laryngeal squamous cell carcinomas - a pilot study.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24279897 2013 BORIS/CTCFL is an RNA-binding protein that associates with polysomes.
More...