Property Summary

NCBI Gene PubMed Count 4
PubMed Score 19.38
PubTator Score 2.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 3.0e-16
osteosarcoma 7950 1.9e-04
Rheumatoid arthritis 1191 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer -1.469 3.0e-16
osteosarcoma 1.157 1.9e-04
Rheumatoid arthritis -1.200 4.2e-02

Synonym

Accession Q8NI38 Q8NI39 Q9BRG9
Symbols TA-NFKBH
IkappaBNS

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAE      1 - 70
VLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNS     71 - 140
GVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTV    141 - 210
LHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLE    211 - 280
NEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS                                         281 - 313
//

Text Mined References (6)

PMID Year Title