Property Summary

NCBI Gene PubMed Count 4
Grant Count 7
R01 Count 7
Funding $1,033,020.5
PubMed Score 17.84
PubTator Score 2.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.042
osteosarcoma 1.157 0.000
non-small cell lung cancer -1.469 0.000

Gene RIF (1)

PMID Text
25349408 The unique ability of p100/IkappaBdelta to stably interact with all NF-kappaB subunits by forming kappaBsomes demonstrates its importance in sequestering NF-kappaB subunits and releasing them as dictated by specific stimuli for developmental programs.

AA Sequence

MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAE      1 - 70
VLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNS     71 - 140
GVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTV    141 - 210
LHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLE    211 - 280
NEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS                                         281 - 313
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25349408 2014 p100/I?B? sequesters and inhibits NF-?B through kappaBsome formation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15177553 2004 T lymphocyte activation gene identification by coregulated expression on DNA microarrays.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.