Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.23
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia 1.300 6.4e-03
adult high grade glioma -1.400 2.1e-06
atypical teratoid / rhabdoid tumor -1.600 2.7e-05
Breast cancer -1.100 9.9e-18
ependymoma -1.300 4.2e-08
group 4 medulloblastoma -1.400 1.5e-04
medulloblastoma, large-cell -1.200 2.8e-04
osteosarcoma 2.074 8.8e-06
ovarian cancer -1.200 7.5e-03
pancreatic cancer 1.100 2.3e-02
Pick disease 1.200 2.2e-04
primary pancreatic ductal adenocarcinoma 1.683 9.0e-04
spina bifida -1.041 4.1e-02

Synonym

Accession Q8NI37 B3KWC5 Q68DZ7 Q6UY82
Symbols TAPP2C
TA-PP2C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

MFSVLSYGRLVARAVLGGLSQTDPRAGGGGGGDYGLVTAGCGFGKDFRKGLLKKGACYGDDACFVARHRS      1 - 70
ADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPIGILTTSYCELLQNKVPLLGSSTAC     71 - 140
IVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSF    141 - 210
DVQLGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDN    211 - 280
GLNVRGGKPDDITVLLSIVAEYTD                                                  281 - 304
//

Text Mined References (6)

PMID Year Title