Property Summary

NCBI Gene PubMed Count 36
PubMed Score 52.02
PubTator Score 37.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Asthma 385 0.0 0.0
Glaucoma 1, Open Angle, G 1 0.0 0.0
Glaucoma, Open-Angle 11 0.0 0.0
Disease Target Count
Glaucoma, Primary Open Angle 8
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Esophagitis 35 0.0 2.2
Disease Target Count Z-score Confidence
Glaucoma 239 5.909 3.0
Disease Target Count Z-score Confidence
Blindness 88 4.303 2.2
Disease Target Count
primary open angle glaucoma 16

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.380 1.1e-06
Breast cancer 2.500 3.9e-02
group 3 medulloblastoma 1.400 1.2e-04
invasive ductal carcinoma -1.100 2.3e-03
ovarian cancer -1.200 4.1e-04
spina bifida 1.158 4.1e-02

 GO Function (1)

Protein-protein Interaction (5)

Gene RIF (35)

AA Sequence

MCCTEGSLRKRDSQRAPEAVLCLQLWQRTVPLDTLKGLGTCFPSGPELRGAGIAAAMERASERRTASALF      1 - 70
AGFRALGLFSNDIPHVVRFSALKRRFYVTTCVGKSFHTYDVQKLSLVAVSNSVPQDICCMAADGRLVFAA     71 - 140
YGNVFSAFARNKEIVHTFKGHKAEIHFLQPFGDHIISVDTDGILIIWHIYSEEEYLQLTFDKSVFKISAI    141 - 210
LHPSTYLNKILLGSEQGSLQLWNVKSNKLLYTFPGWKVGVTALQQAPAVDVVAIGLMSGQVIIHNIKFNE    211 - 280
TLMKFRQDWGPITSISFRTDGHPVMAAGSPCGHIGLWDLEDKKLINQMRNAHSTAIAGLTFLHREPLLVT    281 - 350
NGADNALRIWIFDGPTGEGRLLRFRMGHSAPLTNIRYYGQNGQQILSASQDGTLQSFSTVHEKFNKSLGH    351 - 420
GLINKKRVKRKGLQNTMSVRLPPITKFAAEEARESDWDGIIACHQGKLSCSTWNYQKSTIGAYFLKPKEL    421 - 490
KKDDITATAVDITSCGNFAVIGLSSGTVDVYNMQSGIHRGSFGKDQAHKGSVRGVAVDGLNQLTVTTGSE    491 - 560
GLLKFWNFKNKILIHSVSLSSSPNIMLLHRDSGILGLALDDFSISVLDIETRKIVREFSGHQGQINDMAF    561 - 630
SPDGRWLISAAMDCSIRTWDLPSGCLIDCFLLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVV    631 - 700
SLRPLPADYVPSIVMLPGTCQTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLSLLPESRWKNLLNLDV    701 - 770
IKKKNKPKEPPKVPKSAPFFIPTIPGLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDFCLKLEEGLVNNKY    771 - 840
DTALNLLKESGPSGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPS    841 - 910
EPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL                                 911 - 951
//

Text Mined References (41)

PMID Year Title