Property Summary

NCBI Gene PubMed Count 34
PubMed Score 47.05
PubTator Score 37.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count
Asthma 349
Glaucoma, Primary Open Angle 6
Disease Target Count P-value
acute quadriplegic myopathy 1157 1.08038969546645E-6
group 3 medulloblastoma 2254 1.21396843598984E-4
invasive ductal carcinoma 2950 0.00233558749721091
ovarian cancer 8492 0.026966349425298
Breast cancer 3099 0.0393249929131534
spina bifida 1064 0.0414949336106486
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Esophagitis 26 0.0 2.0
Disease Target Count Z-score Confidence
Glaucoma 135 5.757 2.9
Disease Target Count Z-score Confidence
Blindness 84 4.291 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.380 0.000
Breast cancer 2.500 0.039
group 3 medulloblastoma 1.400 0.000
spina bifida 1.158 0.041
invasive ductal carcinoma -1.100 0.002
ovarian cancer 1.300 0.027

Synonym

Accession Q8NI36 A2RUS4 Q68E02 Q8N1Q2
Symbols GLC1G
UTP21
TAWDRP
TA-WDRP

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GO Function (1)

 GWAS Trait (1)

Gene RIF (33)

PMID Text
26497787 Familial linkage studies for primary angle-closure glaucoma have been performed and identified WDR36 causative primary angle-closure glaucoma disease
25711070 According to molecular genetic studies, WDR36 causative gene involved in the development of Primary open-angle glaucoma.
22174317 HIV-1 Rev interacting protein, WD repeat-containing protein 36 (WDR36), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with WDR36 is increased by RRE
22025897 Single nucleotide polymorphism in the WDR36 gene, rs10038177 (c.710+30C>T), was found to be strongly associated with the high tension glaucoma cases, but not with controls in the East Indian population.
21940795 WDR36 acts as a scaffold protein tethering a G-protein-coupled receptor, Galphaq and phospholipase C beta 2 in a signalling complex
21931130 Rare WDR36 variants and the P53 p.R72P polymorphism behaved as moderate glaucoma risk factors in Spanish patients. The authors provide evidence for a genetic interaction between WDR36 and P53 variants in glaucoma susceptibility.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20813748 WDR36 sequence variance was only a rare cause of primary open-angel glaucoma glaucoma in Italian families with glaucoma.
20208534 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20198978 Genetic variants of CYP1B1 and WDR36 in the patients with primary congenital glaucoma and primary open angle glaucoma from Saint-Petersburg
More...

AA Sequence

MCCTEGSLRKRDSQRAPEAVLCLQLWQRTVPLDTLKGLGTCFPSGPELRGAGIAAAMERASERRTASALF      1 - 70
AGFRALGLFSNDIPHVVRFSALKRRFYVTTCVGKSFHTYDVQKLSLVAVSNSVPQDICCMAADGRLVFAA     71 - 140
YGNVFSAFARNKEIVHTFKGHKAEIHFLQPFGDHIISVDTDGILIIWHIYSEEEYLQLTFDKSVFKISAI    141 - 210
LHPSTYLNKILLGSEQGSLQLWNVKSNKLLYTFPGWKVGVTALQQAPAVDVVAIGLMSGQVIIHNIKFNE    211 - 280
TLMKFRQDWGPITSISFRTDGHPVMAAGSPCGHIGLWDLEDKKLINQMRNAHSTAIAGLTFLHREPLLVT    281 - 350
NGADNALRIWIFDGPTGEGRLLRFRMGHSAPLTNIRYYGQNGQQILSASQDGTLQSFSTVHEKFNKSLGH    351 - 420
GLINKKRVKRKGLQNTMSVRLPPITKFAAEEARESDWDGIIACHQGKLSCSTWNYQKSTIGAYFLKPKEL    421 - 490
KKDDITATAVDITSCGNFAVIGLSSGTVDVYNMQSGIHRGSFGKDQAHKGSVRGVAVDGLNQLTVTTGSE    491 - 560
GLLKFWNFKNKILIHSVSLSSSPNIMLLHRDSGILGLALDDFSISVLDIETRKIVREFSGHQGQINDMAF    561 - 630
SPDGRWLISAAMDCSIRTWDLPSGCLIDCFLLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVV    631 - 700
SLRPLPADYVPSIVMLPGTCQTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLSLLPESRWKNLLNLDV    701 - 770
IKKKNKPKEPPKVPKSAPFFIPTIPGLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDFCLKLEEGLVNNKY    771 - 840
DTALNLLKESGPSGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPS    841 - 910
EPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL                                 911 - 951
//

Text Mined References (39)

PMID Year Title
26497787 2015 Advances in glaucoma genetics.
25711070 [Genetic studies of primary open-angle glaucoma].
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22025897 2011 WDR36 variants in East Indian primary open-angle glaucoma patients.
22002106 2012 Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.
More...