Property Summary

NCBI Gene PubMed Count 34
Grant Count 19
R01 Count 9
Funding $4,102,776.21
PubMed Score 47.05
PubTator Score 37.91

Knowledge Summary


No data available


  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.380 0.000
Breast cancer 2.500 0.039
group 3 medulloblastoma 1.400 0.000
spina bifida 1.158 0.041
invasive ductal carcinoma -1.100 0.002
ovarian cancer 1.300 0.027

 GO Function (1)

Gene RIF (33)

26497787 Familial linkage studies for primary angle-closure glaucoma have been performed and identified WDR36 causative primary angle-closure glaucoma disease
25711070 According to molecular genetic studies, WDR36 causative gene involved in the development of Primary open-angle glaucoma.
22174317 HIV-1 Rev interacting protein, WD repeat-containing protein 36 (WDR36), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with WDR36 is increased by RRE
22025897 Single nucleotide polymorphism in the WDR36 gene, rs10038177 (c.710+30C>T), was found to be strongly associated with the high tension glaucoma cases, but not with controls in the East Indian population.
21940795 WDR36 acts as a scaffold protein tethering a G-protein-coupled receptor, Galphaq and phospholipase C beta 2 in a signalling complex
21931130 Rare WDR36 variants and the P53 p.R72P polymorphism behaved as moderate glaucoma risk factors in Spanish patients. The authors provide evidence for a genetic interaction between WDR36 and P53 variants in glaucoma susceptibility.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20813748 WDR36 sequence variance was only a rare cause of primary open-angel glaucoma glaucoma in Italian families with glaucoma.
20208534 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20198978 Genetic variants of CYP1B1 and WDR36 in the patients with primary congenital glaucoma and primary open angle glaucoma from Saint-Petersburg

AA Sequence

EPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL                                 911 - 951

Text Mined References (39)

PMID Year Title
26497787 2015 Advances in glaucoma genetics.
25711070 [Genetic studies of primary open-angle glaucoma].
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22025897 2011 WDR36 variants in East Indian primary open-angle glaucoma patients.
22002106 2012 Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.