Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.37
PubTator Score 4.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 8.2e-07
group 3 medulloblastoma 4104 3.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.200 3.4e-03
osteosarcoma 1.816 8.2e-07

AA Sequence

MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRALVDGQALWLLI      1 - 70
LARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEE     71 - 140
NRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLD    141 - 210
ANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRV    211 - 280
RLS                                                                       281 - 283
//

Text Mined References (8)

PMID Year Title