Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.07
PubTator Score 4.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.816 0.000
group 3 medulloblastoma -1.200 0.003

AA Sequence

MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRALVDGQALWLLI      1 - 70
LARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEE     71 - 140
NRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLD    141 - 210
ANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRV    211 - 280
RLS                                                                       281 - 283
//

Text Mined References (7)

PMID Year Title
18203720 2008 Diversity in tissue expression, substrate binding, and SCF complex formation for a lectin family of ubiquitin ligases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383498 2002 A new subfamily of structurally related human F-box proteins.
126433 [Clinical conference: Thrombocythemic introduction to chronic myeloid leukemia].