Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
adult high grade glioma 3801 1.2e-04

AA Sequence

MLASPARPTLRMLANHALSTPHCACSPAPAPRTASASRRRCVPVEARAAGVFGDRLAGVFGSRGLKHGGV      1 - 70
QAPRPRVVRAEPRAGFAVVRSPRRLCGRSHAPQPPAHLGLGPGCFPAVAVVVPVPGSRAHRPFAALLVEG     71 - 140
SFLGDPPIPPRRSGVLARGSAGADCLASSVTPGPSLWIPLLLVAGCVSCFVGLAVCVWMQARVSPAWPAG    141 - 210
LFLLPR                                                                    211 - 216
//

Text Mined References (4)

PMID Year Title