Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
adult high grade glioma 2,148

AA Sequence

MLASPARPTLRMLANHALSTPHCACSPAPAPRTASASRRRCVPVEARAAGVFGDRLAGVFGSRGLKHGGV      1 - 70
QAPRPRVVRAEPRAGFAVVRSPRRLCGRSHAPQPPAHLGLGPGCFPAVAVVVPVPGSRAHRPFAALLVEG     71 - 140
SFLGDPPIPPRRSGVLARGSAGADCLASSVTPGPSLWIPLLLVAGCVSCFVGLAVCVWMQARVSPAWPAG    141 - 210
LFLLPR                                                                    211 - 216
//

Text Mined References (4)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
12690205 2003 Human chromosome 7: DNA sequence and biology.
11890671 2002 A double RING-H2 domain in RNF32, a gene expressed during sperm formation.
11181995 2001 The sequence of the human genome.