Property Summary

NCBI Gene PubMed Count 23
Grant Count 119
R01 Count 73
Funding $18,353,039.56
PubMed Score 695.83
PubTator Score 296.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis and treatment for 3 months -1.300 0.000
psoriasis -1.200 0.000

Synonym

Accession Q8NI17 A6NIF8 Q2TBA1 Q6EBC3 Q6EBC4 Q6EBC5 Q6EBC6 Q6UWL8 Q8WYJ0 IL-31 receptor subunit alpha
Symbols CRL
GPL
CRL3
GLMR
GLM-R
PLCA2
hGLM-R
IL-31RA
PRO21384

Gene

Gene RIF (15)

PMID Text
25283844 The interleukin IL-31/IL-31receptor axis contributes to tumor growth in human follicular lymphoma.
24667097 detected in keratinocytes and nerve fibers in the dermis of atopic dermatitis and in the neurons of normal dorsal root ganglia
24373353 IL31RA is a functional receptor expressed by a small subpopulation of IL-31RA(+)/TRPV1(+)/TRPA1(+) neurons and is a critical neuroimmune link between TH2 cells and sensory nerves for the generation of T cell-mediated itch.
23392388 IL-31 and IL-31RA are upregulated in patients with allergic rhinitis, and induce MUC5AC gene expression in human airway epithelial cells.
23333304 HIV-1 Vif modulates the expression of interleukin 31 receptor A (IL31RA) in Vif-expression T cells
20849534 IFN-gamma-induced IL-31RA upregulation in dermal microvascular endothelium is processed via JNK and PI3 kinase activation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19690585 The identification of OSMR and IL31RA gene pathology provides an explanation of the high prevalence of primary cutaneous amyloidosis in Taiwan as well as new insight into disease pathophysiology.
More...

AA Sequence

MMWTWALWMLPSLCKFSLAALPAKPENISCVYYYRKNLTCTWSPGKETSYTQYTVKRTYAFGEKHDNCTT      1 - 70
NSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVIKSHMTYWRLENIAKTEPPKIFRVKPVLGIKRMI     71 - 140
QIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKF    141 - 210
WSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTE    211 - 280
TMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSAL    281 - 350
DVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGV    351 - 420
PSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTSY    421 - 490
IVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNP    491 - 560
AESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQEN    561 - 630
NLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLRSRMPEGTRPEAKEQLLFSGQSLVPDHLC    631 - 700
EEGAPNPYLKNSVTAREFLVSEKLPEHTKGEV                                          701 - 732
//

Text Mined References (26)

PMID Year Title
25283844 2015 The interleukin (IL)-31/IL-31R axis contributes to tumor growth in human follicular lymphoma.
24667097 2014 Distribution of IL-31 and its receptor expressing cells in skin of atopic dermatitis.
24373353 2014 A sensory neuron-expressed IL-31 receptor mediates T helper cell-dependent itch: Involvement of TRPV1 and TRPA1.
23392388 2013 Effects of interleukin-31 on MUC5AC gene expression in nasal allergic inflammation.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21261663 2011 Functional effects of interleukin 31 in human primary keratinocytes.
20849534 2010 Interferon-? induces upregulation and activation of the interleukin-31 receptor in human dermal microvascular endothelial cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
More...