Property Summary

NCBI Gene PubMed Count 22
PubMed Score 13.35
PubTator Score 10.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy 1.558 3.4e-06
adrenocortical carcinoma -1.022 1.7e-04
adult high grade glioma -1.800 3.4e-06
astrocytic glioma -2.100 3.7e-03
Astrocytoma, Pilocytic -1.600 5.3e-09
atypical teratoid / rhabdoid tumor -2.300 2.1e-07
autosomal dominant Emery-Dreifuss muscul... 1.201 4.5e-04
Breast cancer -2.200 2.0e-09
breast carcinoma -1.200 2.6e-04
diabetes mellitus -1.100 7.8e-03
Duchenne muscular dystrophy 1.093 2.1e-06
ependymoma -2.600 1.1e-03
glioblastoma -1.700 1.6e-08
head and neck cancer 1.500 1.6e-03
interstitial lung disease -1.200 4.8e-02
juvenile dermatomyositis 2.262 1.1e-15
medulloblastoma -1.300 3.4e-04
medulloblastoma, large-cell -3.000 2.2e-06
oligodendroglioma -2.000 1.1e-02
ovarian cancer -1.500 1.4e-02
pancreatic cancer 2.000 2.0e-03
pituitary cancer -1.300 4.4e-07
primary pancreatic ductal adenocarcinoma 2.485 1.0e-04
primitive neuroectodermal tumor -1.700 6.7e-06
psoriasis 1.100 1.3e-66
ulcerative colitis 1.500 8.1e-06
urothelial carcinoma -1.700 4.3e-03

Gene RIF (5)

AA Sequence

MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVEEEYMTDEKKK      1 - 70
RKSNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYTAGNQDTLNSIALKFNITPNKLVE     71 - 140
LNKLFTHTIVPGQVLFVPDANSPSSTLRLSSSSPGATVSPSSSDAEYDKLPDADLARKALKPIERVLSST    141 - 210
SEEDEPGVVKFLKMNCRYFTDGKGVVGGVMIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIAL    211 - 280
YNDISHMKIKDALPSDLPQDLCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGEKIMTSDSRPIVP    281 - 350
LEKSTGHTPTKPSGSSVSEKLKKLDSSRETSHGSPTVTKLSKEPSDTSSAFESTAKENFLGEDDDFVDLE    351 - 420
ELSSQTGGGMHKKDTLKECLSLDPEERKKAESQINNSAVEMQVQSALAFLGTENDVELKGALDLETCEKQ    421 - 490
DIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLTKNKEGPQVSENLQKTELSDGKSIEPGGIDITL    491 - 560
SSSLSQAGDPITEGNKEPDKTWVKKGEPLPVKLNSSTEANVIKEALDSSLESTLDNSCQGAQMDNKSEVQ    561 - 630
LWLLKRIQVPIEDILPSKEEKSKTPPMFLCIKVGKPMRKSFATHTAAMVQQYGKRRKQPEYWFAVPRERV    631 - 700
DHLYTFFVQWSPDVYGKDAKEQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEDE    701 - 770
EVLPVLRPHSALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDN    771 - 840
QIFGAYATHPFKFSDHYYGTGETFLYTFSPHFKVFKWSGENSYFINGDISSLELGGGGGRFGLWLDADLY    841 - 910
HGRSNSCSTFNNDILSKKEDFIVQDLEVWAFD                                          911 - 942
//

Text Mined References (30)

PMID Year Title