Property Summary

NCBI Gene PubMed Count 21
Grant Count 1
Funding $41,406.75
PubMed Score 4.56
PubTator Score 4.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Varicocele 21 3.629 1.8
diabetes mellitus 1,663

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.200 0.002

Synonym

Accession Q8NHZ8
Symbols APC12
ANAPC12
C9orf17

Gene

 Grant Application (1)

PDB

4UI9   5A31   5G04   5G05   5KHR   5L9U   5LCW   3HYM  

AA Sequence

MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ      1 - 70
PKPNNRSSQFGSLEF                                                            71 - 85
//

Text Mined References (28)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19668213 2009 Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...