Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.46
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
facioscapulohumeral dystrophy 288 1.1e-36
Disease Target Count Z-score Confidence
Facioscapulohumeral muscular dystrophy 26 3.447 1.7

Gene RIF (3)

AA Sequence

MGEPAFTSFPSLPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDN      1 - 70
QVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRSPLE     71 - 140
PTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARRAEMLTGG      141 - 208
//

Text Mined References (7)

PMID Year Title