Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.78
PubTator Score 2.40

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NHY5 Q5T4Z2 hHUS1B
Symbols

Gene

Gene RIF (3)

PMID Text
26911255 The HUS1B promoter is hypomethylated in the placentas of low-birth-weight infants.
20453000 Observational study of gene-disease association. (HuGE Navigator)
11944979 HUS1B directly interacts with RAD1, but not RAD9 or HUS1, whereas HUS1 can bind RAD1, RAD9, and another molecule of HUS1, suggesting that HUS1B cannot simply substitute for HUS1 in the complex.

AA Sequence

MKFRAKITGKGCLELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAFQQFRMEG      1 - 70
VSEDLDEIHLELTAEHLSRAARSAAGASSLKLQLTHKRRPSLTVAVELVSSLGRARSVVHDLPVRVLPRR     71 - 140
VWRDCLPPSLRASDASIRLPRWRTLRSIVERMANVGSHVLVEANLSGRMTLSIETEVVSIQSYFKNLGNP    141 - 210
PQSAVGVPENRDLESMVQVRVDNRKLLQFLEGQQIHPTTALCNIWDNTLLQLVLVQEDVSLQYFIPAL      211 - 278
//

Text Mined References (11)

PMID Year Title
26911255 2016 The HUS1B promoter is hypomethylated in the placentas of low-birth-weight infants.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24013428 2013 Clamping down on mammalian meiosis.
22773346 2013 Linkage and association of successful aging to the 6q25 region in large Amish kindreds.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14611806 2003 Identification and characterization of RAD9B, a paralog of the RAD9 checkpoint gene.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14500360 2003 Expression of mammalian paralogues of HRAD9 and Mrad9 checkpoint control genes in normal and cancerous testicular tissue.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...