Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.78
PubTator Score 2.40

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NHY5 Q5T4Z2 hHUS1B
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MKFRAKITGKGCLELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAFQQFRMEG      1 - 70
VSEDLDEIHLELTAEHLSRAARSAAGASSLKLQLTHKRRPSLTVAVELVSSLGRARSVVHDLPVRVLPRR     71 - 140
VWRDCLPPSLRASDASIRLPRWRTLRSIVERMANVGSHVLVEANLSGRMTLSIETEVVSIQSYFKNLGNP    141 - 210
PQSAVGVPENRDLESMVQVRVDNRKLLQFLEGQQIHPTTALCNIWDNTLLQLVLVQEDVSLQYFIPAL      211 - 278
//

Text Mined References (11)

PMID Year Title